Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397G5R7

Protein Details
Accession A0A397G5R7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
167-186IPKQVKRRTPERKAVRYRIGBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011722  Hemimethylated_DNA-bd_dom  
IPR036623  Hemimethylated_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF08755  YccV-like  
Amino Acid Sequences MPPSGQDIDGNAIPPATHIEPIFMDPFRSAEETPVENLQNQLNILGASAAEQSTFLGASEVADIVLRCGKNIMNSVQRLSQSSSAHLAPVDAVSARYAALWSSLLFSTSLRPVELRHYLPWFLELFATDFPSDIHLIEQYLVPLFQGTLQQEDILESLHVMGAVDEIPKQVKRRTPERKAVRYRIGQVFRHRRYTYLAVITGWDTECDASEQWMRRMGIDHLEAGRHQSFYHALAEDKSVRYVAEENVDIITPHLSELPRTLVEIAGKHFKRWDGSSHTFVSNIRDEYPDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.14
4 0.16
5 0.15
6 0.17
7 0.18
8 0.21
9 0.24
10 0.19
11 0.18
12 0.16
13 0.17
14 0.18
15 0.2
16 0.18
17 0.18
18 0.21
19 0.22
20 0.24
21 0.27
22 0.25
23 0.22
24 0.24
25 0.22
26 0.2
27 0.18
28 0.16
29 0.12
30 0.11
31 0.1
32 0.08
33 0.06
34 0.06
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.05
49 0.06
50 0.06
51 0.07
52 0.12
53 0.11
54 0.11
55 0.12
56 0.13
57 0.15
58 0.19
59 0.23
60 0.25
61 0.27
62 0.29
63 0.32
64 0.32
65 0.31
66 0.31
67 0.31
68 0.24
69 0.25
70 0.25
71 0.22
72 0.22
73 0.19
74 0.16
75 0.11
76 0.1
77 0.08
78 0.06
79 0.06
80 0.05
81 0.06
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.07
90 0.07
91 0.08
92 0.08
93 0.08
94 0.09
95 0.11
96 0.12
97 0.1
98 0.11
99 0.11
100 0.16
101 0.2
102 0.2
103 0.2
104 0.22
105 0.23
106 0.22
107 0.23
108 0.18
109 0.14
110 0.12
111 0.1
112 0.09
113 0.09
114 0.1
115 0.08
116 0.07
117 0.07
118 0.08
119 0.08
120 0.07
121 0.07
122 0.06
123 0.06
124 0.07
125 0.07
126 0.05
127 0.05
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.06
134 0.06
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.06
142 0.05
143 0.04
144 0.04
145 0.04
146 0.04
147 0.03
148 0.03
149 0.03
150 0.04
151 0.04
152 0.04
153 0.05
154 0.06
155 0.09
156 0.12
157 0.15
158 0.2
159 0.25
160 0.36
161 0.46
162 0.53
163 0.61
164 0.69
165 0.75
166 0.8
167 0.82
168 0.79
169 0.73
170 0.71
171 0.69
172 0.65
173 0.6
174 0.61
175 0.64
176 0.61
177 0.65
178 0.59
179 0.51
180 0.51
181 0.5
182 0.45
183 0.37
184 0.34
185 0.25
186 0.26
187 0.25
188 0.2
189 0.16
190 0.11
191 0.08
192 0.07
193 0.08
194 0.08
195 0.08
196 0.09
197 0.14
198 0.16
199 0.18
200 0.23
201 0.23
202 0.22
203 0.25
204 0.24
205 0.24
206 0.23
207 0.24
208 0.19
209 0.2
210 0.19
211 0.22
212 0.21
213 0.17
214 0.15
215 0.15
216 0.16
217 0.17
218 0.2
219 0.16
220 0.15
221 0.16
222 0.2
223 0.21
224 0.21
225 0.2
226 0.17
227 0.16
228 0.17
229 0.18
230 0.16
231 0.17
232 0.17
233 0.16
234 0.17
235 0.17
236 0.15
237 0.13
238 0.12
239 0.08
240 0.08
241 0.11
242 0.1
243 0.11
244 0.13
245 0.17
246 0.16
247 0.18
248 0.18
249 0.17
250 0.19
251 0.2
252 0.22
253 0.29
254 0.29
255 0.3
256 0.33
257 0.34
258 0.37
259 0.37
260 0.4
261 0.4
262 0.46
263 0.49
264 0.49
265 0.47
266 0.43
267 0.42
268 0.4
269 0.36
270 0.32
271 0.28