Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GMW6

Protein Details
Accession A0A397GMW6   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
109-137ESEIAPPVKKRRTTKRKRADQTNEEDANKHydrophilic
NLS Segment(s)
PositionSequence
100-100R
114-126PPVKKRRTTKRKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPKSTTPVDEQHIFMYHILNGVNDKTINWNTVCKATNLNKGAAHMRWIRLKGKIEDALKGDDDTESADDITAESGNTEVKTEAEKAPGKTMPKMGVFKPRRSKNVNTAESEIAPPVKKRRTTKRKRADQTNEEDANKGASEATAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.17
4 0.16
5 0.15
6 0.13
7 0.12
8 0.12
9 0.13
10 0.12
11 0.12
12 0.17
13 0.18
14 0.2
15 0.2
16 0.22
17 0.22
18 0.28
19 0.28
20 0.23
21 0.29
22 0.32
23 0.4
24 0.39
25 0.4
26 0.34
27 0.36
28 0.38
29 0.31
30 0.31
31 0.25
32 0.26
33 0.29
34 0.31
35 0.32
36 0.34
37 0.38
38 0.35
39 0.37
40 0.39
41 0.36
42 0.35
43 0.34
44 0.3
45 0.26
46 0.24
47 0.19
48 0.12
49 0.11
50 0.09
51 0.08
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.03
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.07
68 0.09
69 0.1
70 0.14
71 0.18
72 0.18
73 0.21
74 0.24
75 0.25
76 0.24
77 0.26
78 0.25
79 0.26
80 0.28
81 0.27
82 0.35
83 0.38
84 0.45
85 0.53
86 0.56
87 0.59
88 0.63
89 0.66
90 0.66
91 0.72
92 0.68
93 0.62
94 0.59
95 0.53
96 0.48
97 0.42
98 0.33
99 0.25
100 0.22
101 0.22
102 0.26
103 0.32
104 0.38
105 0.47
106 0.57
107 0.66
108 0.76
109 0.83
110 0.86
111 0.89
112 0.91
113 0.94
114 0.93
115 0.91
116 0.88
117 0.86
118 0.81
119 0.71
120 0.62
121 0.51
122 0.43
123 0.33
124 0.25
125 0.15
126 0.1