Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JW47

Protein Details
Accession B6JW47    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
108-127DSNSQKTKTTQKRKLTAVNYHydrophilic
515-566ALSPESHQPSKKRKKQTEAWSKQKERKEKRVERREKRRNRREKIREARELGTBasic
609-636DDDYRALKKEKKAKRVDRATKGKKVDILBasic
NLS Segment(s)
PositionSequence
523-561PSKKRKKQTEAWSKQKERKEKRVERREKRRNRREKIREA
615-632LKKEKKAKRVDRATKGKK
Subcellular Location(s) nucl 15, cyto_nucl 12.833, cyto 9.5, mito_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR025313  DUF4217  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
IPR014014  RNA_helicase_DEAD_Q_motif  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0030687  C:preribosome, large subunit precursor  
GO:0005524  F:ATP binding  
GO:0016787  F:hydrolase activity  
GO:0003723  F:RNA binding  
GO:0003724  F:RNA helicase activity  
GO:1902626  P:assembly of large subunit precursor of preribosome  
GO:0000470  P:maturation of LSU-rRNA  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF00270  DEAD  
PF13959  DUF4217  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
PS51195  Q_MOTIF  
CDD cd17960  DEADc_DDX55  
cd18787  SF2_C_DEAD  
Amino Acid Sequences MSFQDLNIEPWLKRAVQAMGFTNMTPVQENSIPLFLKNKDLVVEAVTGSGKTLAYLLPAIQKVLRRDADEIGIGALVIAPTRELATQIFNVTQELLVYQDEDEDKDGDSNSQKTKTTQKRKLTAVNYIGGKDSVAQDIRLYKKTLPEIVIGTPGRINELLDNISTKGLEILILDEADTLIDMGFQKTLQSIISRLPKQRRTGLFSATMNDTISSFLRVAGLRNSVRITVNVAMKQQDARTPLSLSIQSMVVPVKFKLQCLLKLLSTTSFEKAIVFFLSCATVDYFTTLLAGMKLPYDIVPLHGKQAPSNRTRHFEQFVSASKKTVLFTTDVAARGLDIPNVDIVLQMDPPLDPKSFSHRAGRAGRAGKRGLSIVMLHEGREEEYEDLLRVRKVPIQRAEIPEGVCDETALKELVSTLRKACKKDRDIYEKGLRAFVSHVKAYSKHQASFIFRVKELDLPQMATAYALLHLPKMPELRDVEYTDEDFTAEKVDTASIAFRDTNREKARQAALEKQALSPESHQPSKKRKKQTEAWSKQKERKEKRVERREKRRNRREKIREARELGTADSVGKAKEAITSTNDSASEATTKPAEEETVPSDSGEDLSELDDDYRALKKEKKAKRVDRATKGKKVDILSGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.28
4 0.32
5 0.33
6 0.33
7 0.34
8 0.32
9 0.3
10 0.26
11 0.23
12 0.21
13 0.18
14 0.19
15 0.2
16 0.22
17 0.22
18 0.25
19 0.25
20 0.24
21 0.29
22 0.25
23 0.29
24 0.29
25 0.28
26 0.25
27 0.26
28 0.26
29 0.22
30 0.22
31 0.16
32 0.16
33 0.15
34 0.13
35 0.12
36 0.13
37 0.1
38 0.09
39 0.1
40 0.08
41 0.09
42 0.1
43 0.11
44 0.16
45 0.16
46 0.18
47 0.2
48 0.25
49 0.27
50 0.35
51 0.36
52 0.33
53 0.36
54 0.37
55 0.36
56 0.32
57 0.28
58 0.2
59 0.17
60 0.14
61 0.1
62 0.08
63 0.05
64 0.05
65 0.04
66 0.04
67 0.05
68 0.06
69 0.06
70 0.07
71 0.08
72 0.12
73 0.14
74 0.15
75 0.16
76 0.15
77 0.16
78 0.15
79 0.14
80 0.11
81 0.09
82 0.09
83 0.08
84 0.08
85 0.08
86 0.1
87 0.1
88 0.11
89 0.13
90 0.12
91 0.12
92 0.13
93 0.13
94 0.14
95 0.17
96 0.21
97 0.25
98 0.28
99 0.29
100 0.31
101 0.42
102 0.49
103 0.57
104 0.62
105 0.67
106 0.71
107 0.76
108 0.82
109 0.76
110 0.74
111 0.67
112 0.63
113 0.55
114 0.48
115 0.42
116 0.33
117 0.28
118 0.2
119 0.17
120 0.15
121 0.14
122 0.14
123 0.15
124 0.22
125 0.26
126 0.28
127 0.29
128 0.27
129 0.32
130 0.36
131 0.38
132 0.33
133 0.31
134 0.3
135 0.29
136 0.34
137 0.28
138 0.24
139 0.21
140 0.19
141 0.19
142 0.17
143 0.16
144 0.1
145 0.13
146 0.13
147 0.12
148 0.13
149 0.12
150 0.12
151 0.11
152 0.1
153 0.08
154 0.07
155 0.07
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.05
164 0.05
165 0.04
166 0.03
167 0.04
168 0.05
169 0.05
170 0.06
171 0.06
172 0.06
173 0.06
174 0.07
175 0.07
176 0.08
177 0.08
178 0.14
179 0.23
180 0.27
181 0.35
182 0.43
183 0.49
184 0.53
185 0.6
186 0.59
187 0.59
188 0.57
189 0.54
190 0.5
191 0.45
192 0.42
193 0.36
194 0.31
195 0.23
196 0.2
197 0.16
198 0.12
199 0.12
200 0.11
201 0.09
202 0.08
203 0.1
204 0.1
205 0.12
206 0.13
207 0.18
208 0.17
209 0.18
210 0.19
211 0.19
212 0.19
213 0.18
214 0.19
215 0.17
216 0.21
217 0.21
218 0.21
219 0.2
220 0.21
221 0.22
222 0.19
223 0.18
224 0.18
225 0.18
226 0.19
227 0.19
228 0.19
229 0.19
230 0.19
231 0.16
232 0.14
233 0.12
234 0.11
235 0.11
236 0.11
237 0.09
238 0.1
239 0.09
240 0.16
241 0.16
242 0.16
243 0.2
244 0.22
245 0.24
246 0.28
247 0.3
248 0.22
249 0.23
250 0.23
251 0.2
252 0.2
253 0.19
254 0.16
255 0.14
256 0.14
257 0.13
258 0.13
259 0.12
260 0.1
261 0.08
262 0.07
263 0.07
264 0.07
265 0.07
266 0.07
267 0.07
268 0.07
269 0.06
270 0.07
271 0.07
272 0.06
273 0.06
274 0.06
275 0.05
276 0.05
277 0.05
278 0.05
279 0.05
280 0.05
281 0.05
282 0.05
283 0.06
284 0.06
285 0.08
286 0.11
287 0.11
288 0.14
289 0.16
290 0.16
291 0.17
292 0.24
293 0.28
294 0.3
295 0.36
296 0.36
297 0.39
298 0.42
299 0.43
300 0.39
301 0.34
302 0.3
303 0.27
304 0.31
305 0.33
306 0.3
307 0.26
308 0.24
309 0.25
310 0.23
311 0.21
312 0.16
313 0.11
314 0.11
315 0.12
316 0.13
317 0.13
318 0.13
319 0.11
320 0.1
321 0.1
322 0.1
323 0.09
324 0.06
325 0.06
326 0.06
327 0.06
328 0.06
329 0.04
330 0.05
331 0.05
332 0.05
333 0.05
334 0.05
335 0.05
336 0.07
337 0.09
338 0.08
339 0.08
340 0.1
341 0.18
342 0.22
343 0.24
344 0.29
345 0.3
346 0.37
347 0.4
348 0.42
349 0.4
350 0.42
351 0.44
352 0.42
353 0.41
354 0.34
355 0.31
356 0.28
357 0.22
358 0.17
359 0.14
360 0.1
361 0.14
362 0.13
363 0.12
364 0.12
365 0.12
366 0.11
367 0.11
368 0.11
369 0.07
370 0.08
371 0.08
372 0.08
373 0.09
374 0.1
375 0.1
376 0.1
377 0.1
378 0.14
379 0.18
380 0.25
381 0.3
382 0.35
383 0.4
384 0.44
385 0.46
386 0.45
387 0.41
388 0.34
389 0.29
390 0.23
391 0.18
392 0.13
393 0.1
394 0.08
395 0.09
396 0.08
397 0.06
398 0.06
399 0.07
400 0.11
401 0.12
402 0.13
403 0.15
404 0.23
405 0.27
406 0.32
407 0.39
408 0.45
409 0.5
410 0.58
411 0.64
412 0.65
413 0.66
414 0.7
415 0.7
416 0.65
417 0.58
418 0.52
419 0.42
420 0.34
421 0.32
422 0.29
423 0.25
424 0.21
425 0.21
426 0.21
427 0.23
428 0.27
429 0.34
430 0.33
431 0.3
432 0.33
433 0.36
434 0.39
435 0.45
436 0.47
437 0.41
438 0.37
439 0.38
440 0.35
441 0.35
442 0.31
443 0.29
444 0.23
445 0.21
446 0.21
447 0.19
448 0.18
449 0.13
450 0.12
451 0.07
452 0.06
453 0.06
454 0.06
455 0.07
456 0.08
457 0.09
458 0.12
459 0.13
460 0.14
461 0.18
462 0.2
463 0.23
464 0.26
465 0.27
466 0.27
467 0.27
468 0.27
469 0.23
470 0.2
471 0.17
472 0.14
473 0.12
474 0.11
475 0.09
476 0.08
477 0.07
478 0.07
479 0.07
480 0.08
481 0.09
482 0.08
483 0.1
484 0.11
485 0.11
486 0.2
487 0.22
488 0.31
489 0.35
490 0.39
491 0.38
492 0.43
493 0.48
494 0.45
495 0.47
496 0.46
497 0.47
498 0.49
499 0.48
500 0.43
501 0.4
502 0.35
503 0.33
504 0.27
505 0.3
506 0.31
507 0.36
508 0.4
509 0.46
510 0.57
511 0.66
512 0.72
513 0.74
514 0.77
515 0.81
516 0.86
517 0.88
518 0.89
519 0.88
520 0.9
521 0.9
522 0.89
523 0.87
524 0.86
525 0.86
526 0.84
527 0.85
528 0.85
529 0.85
530 0.87
531 0.91
532 0.93
533 0.93
534 0.95
535 0.95
536 0.95
537 0.96
538 0.96
539 0.95
540 0.95
541 0.95
542 0.94
543 0.95
544 0.95
545 0.93
546 0.92
547 0.86
548 0.77
549 0.71
550 0.62
551 0.51
552 0.42
553 0.32
554 0.23
555 0.2
556 0.19
557 0.14
558 0.13
559 0.12
560 0.1
561 0.14
562 0.15
563 0.16
564 0.19
565 0.25
566 0.26
567 0.28
568 0.28
569 0.24
570 0.23
571 0.22
572 0.21
573 0.16
574 0.17
575 0.16
576 0.16
577 0.16
578 0.17
579 0.17
580 0.15
581 0.18
582 0.2
583 0.22
584 0.22
585 0.2
586 0.2
587 0.18
588 0.17
589 0.15
590 0.11
591 0.08
592 0.09
593 0.09
594 0.09
595 0.09
596 0.09
597 0.09
598 0.11
599 0.15
600 0.16
601 0.21
602 0.28
603 0.36
604 0.46
605 0.56
606 0.64
607 0.71
608 0.79
609 0.85
610 0.89
611 0.91
612 0.91
613 0.93
614 0.92
615 0.91
616 0.86
617 0.81
618 0.75
619 0.68