Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K755

Protein Details
Accession B6K755    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-101YYEQILSIRPKKRRRYSWLGWFFRDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 11.332, cyto_nucl 10.333, mito 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037653  Cbp6  
IPR046827  UQCC2/CBP6  
Gene Ontology GO:0061671  C:Cbp3p-Cbp6 complex  
GO:0043022  F:ribosome binding  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
Pfam View protein in Pfam  
PF20180  UQCC2_CBP6  
Amino Acid Sequences MEARLSSIIRQWPKDAARPWVSFPKMLQSSFQSRLQKMNPVEANEQLQSLENLVNNCYSKKYEPNPAILQPKFQPNYYEQILSIRPKKRRRYSWLGWFFRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.47
4 0.49
5 0.49
6 0.51
7 0.53
8 0.5
9 0.44
10 0.41
11 0.42
12 0.37
13 0.36
14 0.33
15 0.29
16 0.34
17 0.37
18 0.43
19 0.38
20 0.36
21 0.41
22 0.4
23 0.43
24 0.37
25 0.41
26 0.37
27 0.35
28 0.35
29 0.32
30 0.32
31 0.24
32 0.24
33 0.16
34 0.14
35 0.1
36 0.09
37 0.08
38 0.07
39 0.08
40 0.08
41 0.09
42 0.1
43 0.1
44 0.11
45 0.12
46 0.14
47 0.21
48 0.24
49 0.31
50 0.33
51 0.39
52 0.41
53 0.44
54 0.5
55 0.43
56 0.43
57 0.37
58 0.43
59 0.39
60 0.36
61 0.34
62 0.28
63 0.34
64 0.33
65 0.31
66 0.23
67 0.25
68 0.28
69 0.32
70 0.38
71 0.4
72 0.46
73 0.55
74 0.66
75 0.72
76 0.78
77 0.81
78 0.83
79 0.85
80 0.87
81 0.88