Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HMG8

Protein Details
Accession A0A397HMG8    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
114-137EEAATPTKPKRQRKTPAKKGAAAKHydrophilic
NLS Segment(s)
PositionSequence
92-103PKKGPAKRKKAV
119-137PTKPKRQRKTPAKKGAAAK
Subcellular Location(s) cyto 18.5, cyto_nucl 11.833, nucl 4, mito_nucl 2.833
Family & Domain DBs
Amino Acid Sequences MASPAKAKPEGILGLSASEAKILLLGFLCITEQYKVDYEKLASKGGYTAGSASVLFLKAKRKLVELNPDNSTENGSSTAGEASSSKPATTTPKKGPAKRKKAVAGAEDGGADGEEAATPTKPKRQRKTPAKKGAAAKAEGGNVENGNSASGVEPEPLKSGDVIKNETVEEGIDDSELTIKAEHEDVMDDAELDAELDALEAAQRGIKAEDAST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.11
5 0.09
6 0.08
7 0.06
8 0.07
9 0.06
10 0.06
11 0.06
12 0.07
13 0.06
14 0.06
15 0.07
16 0.06
17 0.08
18 0.08
19 0.09
20 0.11
21 0.14
22 0.16
23 0.17
24 0.19
25 0.19
26 0.25
27 0.26
28 0.26
29 0.23
30 0.21
31 0.21
32 0.2
33 0.19
34 0.13
35 0.11
36 0.1
37 0.1
38 0.1
39 0.09
40 0.09
41 0.09
42 0.09
43 0.11
44 0.17
45 0.21
46 0.27
47 0.27
48 0.29
49 0.34
50 0.39
51 0.48
52 0.46
53 0.46
54 0.43
55 0.43
56 0.42
57 0.36
58 0.32
59 0.21
60 0.17
61 0.14
62 0.12
63 0.1
64 0.1
65 0.1
66 0.07
67 0.07
68 0.07
69 0.07
70 0.11
71 0.11
72 0.1
73 0.1
74 0.12
75 0.2
76 0.26
77 0.31
78 0.32
79 0.42
80 0.49
81 0.56
82 0.66
83 0.68
84 0.73
85 0.71
86 0.72
87 0.67
88 0.66
89 0.63
90 0.54
91 0.46
92 0.37
93 0.32
94 0.25
95 0.2
96 0.14
97 0.09
98 0.07
99 0.04
100 0.03
101 0.02
102 0.03
103 0.03
104 0.04
105 0.05
106 0.06
107 0.14
108 0.23
109 0.33
110 0.42
111 0.51
112 0.62
113 0.73
114 0.83
115 0.86
116 0.89
117 0.85
118 0.82
119 0.78
120 0.74
121 0.67
122 0.56
123 0.47
124 0.38
125 0.33
126 0.27
127 0.22
128 0.16
129 0.12
130 0.11
131 0.1
132 0.08
133 0.07
134 0.07
135 0.07
136 0.06
137 0.07
138 0.07
139 0.07
140 0.08
141 0.08
142 0.1
143 0.1
144 0.1
145 0.1
146 0.14
147 0.18
148 0.2
149 0.23
150 0.22
151 0.23
152 0.23
153 0.22
154 0.18
155 0.13
156 0.11
157 0.08
158 0.08
159 0.07
160 0.06
161 0.06
162 0.08
163 0.08
164 0.08
165 0.07
166 0.08
167 0.09
168 0.1
169 0.1
170 0.09
171 0.1
172 0.1
173 0.11
174 0.11
175 0.09
176 0.08
177 0.08
178 0.08
179 0.06
180 0.06
181 0.04
182 0.04
183 0.04
184 0.04
185 0.03
186 0.04
187 0.04
188 0.04
189 0.06
190 0.06
191 0.08
192 0.09
193 0.12