Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K0T0

Protein Details
Accession B6K0T0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
138-161EKEAHEKIQKLKKQGKKIKRSRRHBasic
NLS Segment(s)
PositionSequence
75-104RAKPLPKPKPETRWQKFARIKGIAPKKREG
144-161KIQKLKKQGKKIKRSRRH
Subcellular Location(s) nucl 13.5, mito_nucl 9.833, cyto 8.5, cyto_mito 7.333, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0042273  P:ribosomal large subunit biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSVHVEKELPLELDLGNMCAFDIAPVSKGIKEEQLRALARDNAQVLINQMFSLPTESTKDGLLLLLPDGTTPLPRAKPLPKPKPETRWQKFARIKGIAPKKREGKLVYDEASGEWVPRWGYGGKNKALDNQWLVEEGEKEAHEKIQKLKKQGKKIKRSRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.09
5 0.09
6 0.08
7 0.07
8 0.05
9 0.07
10 0.06
11 0.07
12 0.09
13 0.11
14 0.12
15 0.13
16 0.14
17 0.2
18 0.22
19 0.25
20 0.28
21 0.34
22 0.33
23 0.34
24 0.36
25 0.32
26 0.31
27 0.3
28 0.27
29 0.21
30 0.2
31 0.19
32 0.17
33 0.14
34 0.13
35 0.1
36 0.09
37 0.08
38 0.08
39 0.1
40 0.08
41 0.08
42 0.11
43 0.12
44 0.13
45 0.13
46 0.13
47 0.1
48 0.1
49 0.09
50 0.06
51 0.05
52 0.05
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.06
59 0.09
60 0.1
61 0.11
62 0.15
63 0.19
64 0.29
65 0.39
66 0.48
67 0.52
68 0.6
69 0.65
70 0.69
71 0.73
72 0.75
73 0.69
74 0.69
75 0.64
76 0.67
77 0.66
78 0.63
79 0.62
80 0.53
81 0.5
82 0.49
83 0.57
84 0.52
85 0.5
86 0.53
87 0.52
88 0.52
89 0.57
90 0.49
91 0.44
92 0.45
93 0.46
94 0.4
95 0.34
96 0.31
97 0.26
98 0.26
99 0.21
100 0.15
101 0.1
102 0.09
103 0.09
104 0.09
105 0.11
106 0.1
107 0.15
108 0.23
109 0.29
110 0.32
111 0.35
112 0.36
113 0.4
114 0.41
115 0.41
116 0.35
117 0.31
118 0.27
119 0.25
120 0.25
121 0.2
122 0.18
123 0.15
124 0.15
125 0.14
126 0.15
127 0.14
128 0.19
129 0.21
130 0.23
131 0.31
132 0.39
133 0.44
134 0.52
135 0.61
136 0.65
137 0.73
138 0.8
139 0.82
140 0.83
141 0.89