Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HB90

Protein Details
Accession A0A397HB90    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
73-115RATYNPSRRVQKRRHGFLARLRSRGGRKVLQHRREKGRKSLSWHydrophilic
NLS Segment(s)
PositionSequence
79-112SRRVQKRRHGFLARLRSRGGRKVLQHRREKGRKS
Subcellular Location(s) mito 13, nucl 11, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MRSQSFRLPTQTLTTSLSTPLRTFSSALRSQPTPLTQSLPSFRTSLTSASSLSFGLTQQTRSFSASASLAGRRATYNPSRRVQKRRHGFLARLRSRGGRKVLQHRREKGRKSLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.26
3 0.27
4 0.28
5 0.24
6 0.22
7 0.22
8 0.21
9 0.2
10 0.21
11 0.19
12 0.25
13 0.27
14 0.29
15 0.3
16 0.29
17 0.3
18 0.32
19 0.31
20 0.27
21 0.24
22 0.25
23 0.22
24 0.25
25 0.27
26 0.25
27 0.24
28 0.21
29 0.2
30 0.19
31 0.19
32 0.16
33 0.15
34 0.14
35 0.13
36 0.13
37 0.13
38 0.11
39 0.1
40 0.09
41 0.07
42 0.09
43 0.08
44 0.09
45 0.09
46 0.11
47 0.12
48 0.13
49 0.13
50 0.11
51 0.12
52 0.11
53 0.11
54 0.11
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.12
61 0.16
62 0.23
63 0.31
64 0.37
65 0.43
66 0.52
67 0.59
68 0.68
69 0.72
70 0.74
71 0.76
72 0.77
73 0.8
74 0.77
75 0.75
76 0.75
77 0.77
78 0.72
79 0.65
80 0.59
81 0.56
82 0.55
83 0.56
84 0.53
85 0.49
86 0.52
87 0.6
88 0.69
89 0.72
90 0.77
91 0.79
92 0.83
93 0.86
94 0.85
95 0.84