Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K5U6

Protein Details
Accession B6K5U6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
70-94TSGSEPEKKMKKKKRSEKVQDTVQAHydrophilic
NLS Segment(s)
PositionSequence
77-85KKMKKKKRS
161-171NSPKRKSGGRK
Subcellular Location(s) nucl 13, cyto_nucl 10.833, mito_nucl 8.333, cyto 7.5, mito 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPEEHGKTYAEVLKETASPQTREEKAAPPPLEVKSTVSDVAEGEENTKVQVVPEDQASEYLEEEAGNEETSGSEPEKKMKKKKRSEKVQDTVQAKSASMLDCLKNWIIPLDIFGVGAISAYVLQKRQAGTLTKQVLFTCTALTGALMATSYIVKKSHIPANSPKRKSGGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.24
4 0.24
5 0.25
6 0.27
7 0.34
8 0.34
9 0.37
10 0.39
11 0.37
12 0.4
13 0.47
14 0.45
15 0.39
16 0.41
17 0.39
18 0.38
19 0.34
20 0.29
21 0.23
22 0.24
23 0.22
24 0.18
25 0.17
26 0.14
27 0.15
28 0.14
29 0.11
30 0.11
31 0.11
32 0.1
33 0.1
34 0.11
35 0.09
36 0.07
37 0.1
38 0.1
39 0.1
40 0.11
41 0.12
42 0.12
43 0.13
44 0.13
45 0.11
46 0.1
47 0.09
48 0.08
49 0.06
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.08
59 0.07
60 0.09
61 0.1
62 0.17
63 0.25
64 0.32
65 0.42
66 0.5
67 0.6
68 0.68
69 0.78
70 0.82
71 0.85
72 0.89
73 0.89
74 0.86
75 0.82
76 0.78
77 0.7
78 0.6
79 0.53
80 0.42
81 0.32
82 0.26
83 0.21
84 0.14
85 0.14
86 0.15
87 0.11
88 0.11
89 0.13
90 0.13
91 0.11
92 0.11
93 0.1
94 0.09
95 0.08
96 0.09
97 0.09
98 0.09
99 0.09
100 0.08
101 0.08
102 0.06
103 0.06
104 0.05
105 0.03
106 0.03
107 0.04
108 0.05
109 0.06
110 0.08
111 0.1
112 0.11
113 0.13
114 0.16
115 0.2
116 0.23
117 0.31
118 0.35
119 0.34
120 0.35
121 0.34
122 0.32
123 0.29
124 0.26
125 0.18
126 0.13
127 0.12
128 0.1
129 0.1
130 0.08
131 0.06
132 0.06
133 0.05
134 0.04
135 0.05
136 0.06
137 0.07
138 0.09
139 0.1
140 0.11
141 0.15
142 0.21
143 0.27
144 0.29
145 0.34
146 0.43
147 0.54
148 0.63
149 0.63
150 0.62
151 0.62