Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K006

Protein Details
Accession B6K006    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
39-58YPAAKTRKYNWNPKAKRRKTHydrophilic
NLS Segment(s)
PositionSequence
50-66NPKAKRRKTTGTGRMRY
68-68K
Subcellular Location(s) mito 13, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCASCGYPAAKTRKYNWNPKAKRRKTTGTGRMRYLKEVHRRFANGFRAGKPAAAAAESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.6
4 0.58
5 0.63
6 0.68
7 0.71
8 0.69
9 0.74
10 0.71
11 0.7
12 0.73
13 0.76
14 0.75
15 0.76
16 0.72
17 0.69
18 0.68
19 0.61
20 0.51
21 0.42
22 0.33
23 0.24
24 0.28
25 0.22
26 0.19
27 0.23
28 0.28
29 0.32
30 0.34
31 0.37
32 0.43
33 0.48
34 0.56
35 0.58
36 0.63
37 0.65
38 0.74
39 0.81
40 0.78
41 0.79
42 0.76
43 0.76
44 0.73
45 0.76
46 0.76
47 0.75
48 0.72
49 0.7
50 0.71
51 0.64
52 0.6
53 0.54
54 0.53
55 0.53
56 0.54
57 0.54
58 0.52
59 0.54
60 0.53
61 0.57
62 0.56
63 0.54
64 0.52
65 0.48
66 0.48
67 0.45
68 0.42
69 0.34
70 0.27
71 0.2