Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GBQ7

Protein Details
Accession A0A397GBQ7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-120LDEETRKEKEEKKRNHHHHPEGLABasic
NLS Segment(s)
PositionSequence
103-126KEKEEKKRNHHHHPEGLADKLKHK
Subcellular Location(s) cyto_nucl 12.5, nucl 11.5, cyto 10.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MVEQEPVVSHGRGGQGNIGADPTQYVDAGIVREGPYGDQGDGAYSAGRGGAGNIGSPNVRPTSRVPHDAEIIPELAIRKSTDENFHVGRGGQGNVHLDEETRKEKEEKKRNHHHHPEGLADKLKHKLFGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.2
5 0.18
6 0.14
7 0.13
8 0.13
9 0.11
10 0.09
11 0.08
12 0.08
13 0.07
14 0.08
15 0.09
16 0.09
17 0.08
18 0.08
19 0.09
20 0.09
21 0.09
22 0.1
23 0.11
24 0.1
25 0.09
26 0.09
27 0.09
28 0.09
29 0.09
30 0.07
31 0.05
32 0.05
33 0.04
34 0.05
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.07
44 0.08
45 0.08
46 0.08
47 0.1
48 0.12
49 0.21
50 0.24
51 0.29
52 0.3
53 0.3
54 0.32
55 0.3
56 0.29
57 0.21
58 0.18
59 0.12
60 0.11
61 0.1
62 0.08
63 0.08
64 0.08
65 0.09
66 0.11
67 0.13
68 0.16
69 0.17
70 0.21
71 0.21
72 0.21
73 0.2
74 0.17
75 0.17
76 0.15
77 0.14
78 0.11
79 0.11
80 0.13
81 0.13
82 0.14
83 0.12
84 0.11
85 0.13
86 0.17
87 0.2
88 0.19
89 0.21
90 0.25
91 0.33
92 0.44
93 0.52
94 0.58
95 0.64
96 0.74
97 0.81
98 0.87
99 0.9
100 0.88
101 0.86
102 0.79
103 0.77
104 0.69
105 0.65
106 0.61
107 0.52
108 0.47
109 0.46
110 0.44
111 0.42