Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PL49

Protein Details
Accession B8PL49    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-32KAAAKASKKSTAQKKEKLFHPQSRKAGQHydrophilic
NLS Segment(s)
PositionSequence
5-44KAAAKASKKSTAQKKEKLFHPQSRKAGQLARVQHRKDKLT
47-53ARARVGK
107-117ARRKGRPKSVK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021346  Tma16  
IPR038356  Tma16_sf  
KEGG ppl:POSPLDRAFT_96160  -  
Pfam View protein in Pfam  
PF11176  Tma16  
Amino Acid Sequences MAPPKAAAKASKKSTAQKKEKLFHPQSRKAGQLARVQHRKDKLTDLARARVGKRRSQVLSTISADIYSFFYKALPPEGVLSLEELHLIVRDIWMTRFDSEIEEEKNARRKGRPKSVKEQKLEEIKLREAEEYRTGLEVVDLTDPPNVELFRRWDQKEVAFIQQLRFIRIAGDAPSLVVISRPGQHPSLVQSNQTNVELKDQEMDTDDAPLLMEPLSRFASTIMTMDGTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.77
4 0.77
5 0.8
6 0.8
7 0.82
8 0.83
9 0.82
10 0.81
11 0.81
12 0.82
13 0.8
14 0.77
15 0.73
16 0.66
17 0.63
18 0.59
19 0.56
20 0.56
21 0.58
22 0.61
23 0.61
24 0.64
25 0.64
26 0.62
27 0.58
28 0.55
29 0.53
30 0.51
31 0.56
32 0.53
33 0.52
34 0.53
35 0.54
36 0.5
37 0.5
38 0.48
39 0.47
40 0.46
41 0.49
42 0.47
43 0.45
44 0.48
45 0.43
46 0.44
47 0.4
48 0.36
49 0.28
50 0.25
51 0.22
52 0.18
53 0.17
54 0.12
55 0.1
56 0.08
57 0.09
58 0.1
59 0.11
60 0.13
61 0.11
62 0.1
63 0.12
64 0.12
65 0.13
66 0.12
67 0.12
68 0.09
69 0.09
70 0.08
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.04
77 0.05
78 0.05
79 0.06
80 0.08
81 0.09
82 0.09
83 0.1
84 0.1
85 0.1
86 0.12
87 0.14
88 0.14
89 0.14
90 0.14
91 0.17
92 0.25
93 0.26
94 0.27
95 0.3
96 0.37
97 0.44
98 0.55
99 0.61
100 0.6
101 0.69
102 0.77
103 0.79
104 0.74
105 0.69
106 0.64
107 0.62
108 0.57
109 0.5
110 0.43
111 0.36
112 0.35
113 0.31
114 0.27
115 0.2
116 0.2
117 0.18
118 0.16
119 0.15
120 0.14
121 0.13
122 0.11
123 0.1
124 0.08
125 0.07
126 0.07
127 0.07
128 0.07
129 0.08
130 0.08
131 0.08
132 0.1
133 0.09
134 0.08
135 0.11
136 0.16
137 0.23
138 0.3
139 0.31
140 0.33
141 0.35
142 0.36
143 0.39
144 0.36
145 0.33
146 0.3
147 0.3
148 0.28
149 0.31
150 0.29
151 0.26
152 0.23
153 0.19
154 0.16
155 0.16
156 0.16
157 0.12
158 0.13
159 0.1
160 0.1
161 0.1
162 0.09
163 0.08
164 0.07
165 0.07
166 0.08
167 0.11
168 0.13
169 0.16
170 0.17
171 0.18
172 0.19
173 0.23
174 0.3
175 0.28
176 0.3
177 0.29
178 0.31
179 0.33
180 0.34
181 0.31
182 0.23
183 0.28
184 0.25
185 0.23
186 0.25
187 0.22
188 0.21
189 0.21
190 0.22
191 0.16
192 0.17
193 0.16
194 0.12
195 0.12
196 0.11
197 0.09
198 0.07
199 0.09
200 0.08
201 0.12
202 0.14
203 0.14
204 0.14
205 0.14
206 0.17
207 0.16
208 0.17
209 0.14