Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GS80

Protein Details
Accession A0A397GS80    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-67DDQPKPKNKARKETDRGRGRGBasic
NLS Segment(s)
PositionSequence
51-87KPKNKARKETDRGRGRGGGGGRGGRGRGRGRGRGRGF
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
Gene Ontology GO:0120114  C:Sm-like protein family complex  
GO:0006396  P:RNA processing  
Amino Acid Sequences MNTALRTVKMTPKGREPISLDTINIRGSTIRYYILPDSLPLDTLLVDDQPKPKNKARKETDRGRGRGGGGGRGGRGRGRGRGRGRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.54
4 0.51
5 0.5
6 0.47
7 0.38
8 0.33
9 0.33
10 0.28
11 0.23
12 0.17
13 0.11
14 0.11
15 0.13
16 0.11
17 0.11
18 0.1
19 0.13
20 0.13
21 0.14
22 0.13
23 0.11
24 0.12
25 0.11
26 0.11
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.05
33 0.06
34 0.07
35 0.12
36 0.16
37 0.21
38 0.26
39 0.32
40 0.41
41 0.47
42 0.57
43 0.61
44 0.67
45 0.71
46 0.76
47 0.8
48 0.81
49 0.77
50 0.7
51 0.64
52 0.54
53 0.5
54 0.41
55 0.35
56 0.29
57 0.27
58 0.25
59 0.24
60 0.24
61 0.21
62 0.27
63 0.27
64 0.33
65 0.39
66 0.47
67 0.52