Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HIS0

Protein Details
Accession A0A397HIS0    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-83NQKCREDWAKILRRKRDERKSSRSBasic
NLS Segment(s)
PositionSequence
71-82LRRKRDERKSSR
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF12796  Ank_2  
PROSITE View protein in PROSITE  
PS50088  ANK_REPEAT  
Amino Acid Sequences MVELLLDHGADINRKDPKGRTPLLHAMLWNNDQIVEFLLLYDVDPDAESHDGLTPLKLANQKCREDWAKILRRKRDERKSSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.29
4 0.36
5 0.42
6 0.45
7 0.42
8 0.44
9 0.52
10 0.51
11 0.49
12 0.42
13 0.35
14 0.34
15 0.32
16 0.24
17 0.16
18 0.13
19 0.12
20 0.11
21 0.1
22 0.07
23 0.06
24 0.05
25 0.06
26 0.05
27 0.05
28 0.05
29 0.04
30 0.03
31 0.04
32 0.04
33 0.05
34 0.06
35 0.06
36 0.06
37 0.07
38 0.07
39 0.07
40 0.08
41 0.07
42 0.07
43 0.11
44 0.15
45 0.17
46 0.26
47 0.34
48 0.37
49 0.37
50 0.45
51 0.45
52 0.44
53 0.49
54 0.5
55 0.53
56 0.58
57 0.65
58 0.67
59 0.73
60 0.8
61 0.83
62 0.84
63 0.85