Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8P3W7

Protein Details
Accession B8P3W7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-36TSSSGGKAAKKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
12-30SGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG ppl:POSPLDRAFT_109937  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPTSSSGGKAAKKKKWSKGKVKDKAQHAVILDKPTYDRIMKEVPTFRFISQSILIERLKVNGSLARVAISHLEKEGQIKRIVHHSGQLIYTRSTSGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.45
4 0.47
5 0.56
6 0.63
7 0.71
8 0.77
9 0.82
10 0.84
11 0.86
12 0.9
13 0.9
14 0.91
15 0.88
16 0.84
17 0.8
18 0.71
19 0.63
20 0.53
21 0.47
22 0.4
23 0.35
24 0.29
25 0.22
26 0.21
27 0.19
28 0.2
29 0.16
30 0.14
31 0.14
32 0.17
33 0.18
34 0.22
35 0.26
36 0.25
37 0.27
38 0.29
39 0.25
40 0.24
41 0.23
42 0.22
43 0.18
44 0.18
45 0.15
46 0.17
47 0.17
48 0.16
49 0.16
50 0.14
51 0.14
52 0.12
53 0.13
54 0.11
55 0.12
56 0.12
57 0.12
58 0.11
59 0.1
60 0.11
61 0.14
62 0.13
63 0.12
64 0.12
65 0.12
66 0.12
67 0.18
68 0.22
69 0.22
70 0.26
71 0.26
72 0.28
73 0.35
74 0.39
75 0.34
76 0.34
77 0.34
78 0.32
79 0.33
80 0.35
81 0.3
82 0.27
83 0.27
84 0.23