Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397G5B2

Protein Details
Accession A0A397G5B2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAAGAGKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
6-19GKQKKKWSKGKVKD
Subcellular Location(s) cyto 14, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAAGAGKQKKKWSKGKVKDKAQHAVVLEKQTAERLQKDVQSYRLITVATLVDRLKINGSLARKALADLEEKGQIKKVVGHSKMTIYSMFGPHFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.88
3 0.89
4 0.9
5 0.89
6 0.85
7 0.82
8 0.73
9 0.66
10 0.56
11 0.51
12 0.43
13 0.39
14 0.32
15 0.25
16 0.23
17 0.21
18 0.22
19 0.2
20 0.18
21 0.18
22 0.2
23 0.23
24 0.27
25 0.27
26 0.27
27 0.27
28 0.26
29 0.23
30 0.22
31 0.19
32 0.15
33 0.13
34 0.11
35 0.08
36 0.09
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.1
44 0.12
45 0.14
46 0.15
47 0.16
48 0.16
49 0.16
50 0.15
51 0.16
52 0.14
53 0.14
54 0.13
55 0.15
56 0.19
57 0.2
58 0.21
59 0.22
60 0.22
61 0.2
62 0.24
63 0.31
64 0.35
65 0.37
66 0.4
67 0.39
68 0.42
69 0.43
70 0.39
71 0.31
72 0.25
73 0.26
74 0.26