Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HQM1

Protein Details
Accession A0A397HQM1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
134-159VDTVPDRSRQKKQRKKLAARKSKSEHBasic
NLS Segment(s)
PositionSequence
141-168SRQKKQRKKLAARKSKSEHAKGSWKKFG
Subcellular Location(s) cyto 18, cyto_nucl 12, nucl 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002483  PWI_dom  
IPR036483  PWI_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF01480  PWI  
PROSITE View protein in PROSITE  
PS51025  PWI  
Amino Acid Sequences MASSIDAKLLKQTKFPPEFSRKVDMKKVNIEVMKKWIAGKISEILGNEDDVVIELCFNLLEGSRFPDIKSLQIQLTGFLDKDTAKFCKDLWSLCLSAQENPQGVPKELLEAKKLELIQEKVGLLDCWPGFISDVDTVPDRSRQKKQRKKLAARKSKSEHAKGSWKKFGKENDGIAIGAGEVAVVEAETSIDGHTETIDRHPGDEAASDFVTHPQDESLILTFPQVRVGAVGLQDRRAPLAPALVPFPHLDPHLVDASQAETDTEINVAAPRVALFLQTEETRGNREDAVQTTVIELDPFPAVIHRAHVLPEEIEGDEDLSLPTVHPVHLLPETGAEGKTGRARGRGLGRGLGREVWMRRAADGGDPHLISQELIRKNQPLILQRPASPVMIAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.6
4 0.62
5 0.68
6 0.67
7 0.69
8 0.65
9 0.66
10 0.71
11 0.69
12 0.66
13 0.67
14 0.66
15 0.64
16 0.63
17 0.59
18 0.52
19 0.52
20 0.49
21 0.42
22 0.39
23 0.34
24 0.32
25 0.29
26 0.29
27 0.25
28 0.24
29 0.25
30 0.24
31 0.23
32 0.21
33 0.21
34 0.17
35 0.14
36 0.11
37 0.1
38 0.1
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.07
49 0.12
50 0.15
51 0.16
52 0.16
53 0.22
54 0.22
55 0.25
56 0.28
57 0.27
58 0.24
59 0.28
60 0.28
61 0.23
62 0.24
63 0.21
64 0.17
65 0.14
66 0.15
67 0.12
68 0.14
69 0.16
70 0.16
71 0.17
72 0.17
73 0.18
74 0.26
75 0.27
76 0.28
77 0.27
78 0.29
79 0.28
80 0.28
81 0.34
82 0.26
83 0.27
84 0.28
85 0.28
86 0.24
87 0.24
88 0.28
89 0.24
90 0.24
91 0.23
92 0.19
93 0.2
94 0.24
95 0.25
96 0.22
97 0.21
98 0.21
99 0.24
100 0.24
101 0.22
102 0.23
103 0.24
104 0.23
105 0.24
106 0.23
107 0.19
108 0.2
109 0.17
110 0.12
111 0.15
112 0.12
113 0.11
114 0.11
115 0.11
116 0.11
117 0.11
118 0.13
119 0.09
120 0.1
121 0.1
122 0.11
123 0.12
124 0.12
125 0.19
126 0.21
127 0.26
128 0.35
129 0.44
130 0.55
131 0.64
132 0.73
133 0.78
134 0.84
135 0.89
136 0.9
137 0.91
138 0.91
139 0.86
140 0.85
141 0.79
142 0.76
143 0.73
144 0.69
145 0.62
146 0.56
147 0.62
148 0.6
149 0.61
150 0.61
151 0.56
152 0.53
153 0.54
154 0.54
155 0.52
156 0.49
157 0.44
158 0.37
159 0.35
160 0.32
161 0.26
162 0.2
163 0.12
164 0.07
165 0.05
166 0.03
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.03
178 0.03
179 0.03
180 0.04
181 0.04
182 0.05
183 0.06
184 0.1
185 0.1
186 0.1
187 0.11
188 0.11
189 0.1
190 0.11
191 0.1
192 0.08
193 0.08
194 0.08
195 0.08
196 0.1
197 0.11
198 0.1
199 0.09
200 0.07
201 0.08
202 0.07
203 0.08
204 0.07
205 0.06
206 0.06
207 0.07
208 0.08
209 0.07
210 0.09
211 0.08
212 0.07
213 0.07
214 0.08
215 0.08
216 0.09
217 0.13
218 0.11
219 0.12
220 0.13
221 0.13
222 0.14
223 0.13
224 0.13
225 0.09
226 0.12
227 0.12
228 0.12
229 0.14
230 0.13
231 0.13
232 0.13
233 0.13
234 0.12
235 0.11
236 0.11
237 0.1
238 0.13
239 0.13
240 0.12
241 0.11
242 0.1
243 0.11
244 0.1
245 0.09
246 0.07
247 0.06
248 0.06
249 0.06
250 0.06
251 0.05
252 0.05
253 0.05
254 0.06
255 0.05
256 0.05
257 0.05
258 0.06
259 0.06
260 0.06
261 0.06
262 0.07
263 0.1
264 0.1
265 0.11
266 0.11
267 0.12
268 0.14
269 0.15
270 0.16
271 0.14
272 0.16
273 0.18
274 0.18
275 0.21
276 0.19
277 0.18
278 0.17
279 0.17
280 0.15
281 0.12
282 0.1
283 0.07
284 0.07
285 0.07
286 0.06
287 0.07
288 0.08
289 0.08
290 0.1
291 0.1
292 0.11
293 0.12
294 0.13
295 0.14
296 0.12
297 0.13
298 0.13
299 0.11
300 0.11
301 0.1
302 0.1
303 0.08
304 0.08
305 0.07
306 0.06
307 0.06
308 0.06
309 0.08
310 0.08
311 0.08
312 0.09
313 0.1
314 0.12
315 0.14
316 0.14
317 0.12
318 0.13
319 0.15
320 0.15
321 0.15
322 0.13
323 0.12
324 0.14
325 0.19
326 0.22
327 0.22
328 0.24
329 0.26
330 0.32
331 0.39
332 0.42
333 0.4
334 0.42
335 0.42
336 0.42
337 0.42
338 0.37
339 0.31
340 0.31
341 0.31
342 0.3
343 0.33
344 0.3
345 0.29
346 0.3
347 0.29
348 0.28
349 0.29
350 0.27
351 0.27
352 0.26
353 0.26
354 0.25
355 0.24
356 0.18
357 0.19
358 0.24
359 0.24
360 0.28
361 0.32
362 0.34
363 0.35
364 0.39
365 0.41
366 0.42
367 0.42
368 0.48
369 0.48
370 0.47
371 0.51
372 0.5
373 0.44