Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HVT7

Protein Details
Accession A0A397HVT7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
45-69VPTAVFYRTWRKRRNASPSRHAELEHydrophilic
304-333IGLAVQKVKREWKKVKKYEHDHSKDGKRQKBasic
NLS Segment(s)
PositionSequence
312-333KREWKKVKKYEHDHSKDGKRQK
Subcellular Location(s) mito 9, extr 8, plas 4, cyto 3, pero 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR026898  PrsW  
Gene Ontology GO:0016020  C:membrane  
GO:0008233  F:peptidase activity  
Pfam View protein in Pfam  
PF13367  PrsW-protease  
Amino Acid Sequences MSSVAPNSSLSLSTRLLCYLGPPSALLLIATTSPKAALLSPLSLVPTAVFYRTWRKRRNASPSRHAELEPLLWTFTLSGTLGLAAAAAVQMGICQAMSAVLFSSDELRTEFWTEFGRTTIAGLIEEQLGRRAELASSWQNWVFNGALTYLAAGLVEEVLKYIPVIYARRRDVTKKQRRERAYIDYVLAGALGFSVVENIGFIYTACEGGQESWPRLLLTFVERVVLGQLGHLSVACLTALRATRRDYFGDSLGLWGVIGPAVYFHGTYNFAVMSASAMEGNVGWIHPKGLRNSVLVLGLVSGIIGLAVQKVKREWKKVKKYEHDHSKDGKRQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.19
4 0.17
5 0.18
6 0.18
7 0.18
8 0.17
9 0.16
10 0.16
11 0.16
12 0.16
13 0.13
14 0.09
15 0.08
16 0.09
17 0.1
18 0.1
19 0.09
20 0.09
21 0.1
22 0.1
23 0.1
24 0.12
25 0.14
26 0.15
27 0.15
28 0.16
29 0.17
30 0.16
31 0.15
32 0.11
33 0.12
34 0.11
35 0.12
36 0.12
37 0.14
38 0.25
39 0.35
40 0.45
41 0.5
42 0.58
43 0.67
44 0.76
45 0.84
46 0.83
47 0.83
48 0.83
49 0.83
50 0.8
51 0.73
52 0.64
53 0.55
54 0.47
55 0.4
56 0.31
57 0.23
58 0.17
59 0.14
60 0.14
61 0.12
62 0.1
63 0.09
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.06
70 0.05
71 0.03
72 0.03
73 0.03
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.05
90 0.07
91 0.07
92 0.08
93 0.09
94 0.09
95 0.1
96 0.13
97 0.13
98 0.11
99 0.14
100 0.15
101 0.14
102 0.14
103 0.13
104 0.11
105 0.11
106 0.11
107 0.09
108 0.08
109 0.07
110 0.08
111 0.08
112 0.08
113 0.08
114 0.1
115 0.1
116 0.09
117 0.1
118 0.09
119 0.08
120 0.08
121 0.13
122 0.13
123 0.14
124 0.16
125 0.16
126 0.16
127 0.16
128 0.18
129 0.13
130 0.1
131 0.09
132 0.07
133 0.07
134 0.06
135 0.06
136 0.04
137 0.04
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.02
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.04
150 0.06
151 0.09
152 0.12
153 0.19
154 0.21
155 0.24
156 0.26
157 0.3
158 0.38
159 0.47
160 0.54
161 0.59
162 0.66
163 0.71
164 0.74
165 0.75
166 0.7
167 0.67
168 0.62
169 0.53
170 0.45
171 0.36
172 0.32
173 0.25
174 0.2
175 0.11
176 0.05
177 0.03
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.03
186 0.03
187 0.03
188 0.03
189 0.04
190 0.04
191 0.05
192 0.05
193 0.05
194 0.06
195 0.07
196 0.12
197 0.12
198 0.13
199 0.14
200 0.15
201 0.14
202 0.14
203 0.13
204 0.1
205 0.11
206 0.12
207 0.12
208 0.12
209 0.11
210 0.11
211 0.11
212 0.11
213 0.08
214 0.06
215 0.06
216 0.06
217 0.06
218 0.06
219 0.05
220 0.04
221 0.05
222 0.04
223 0.04
224 0.04
225 0.07
226 0.11
227 0.14
228 0.16
229 0.2
230 0.25
231 0.27
232 0.3
233 0.3
234 0.29
235 0.28
236 0.27
237 0.23
238 0.2
239 0.17
240 0.15
241 0.11
242 0.08
243 0.06
244 0.05
245 0.04
246 0.03
247 0.03
248 0.05
249 0.06
250 0.06
251 0.06
252 0.09
253 0.11
254 0.11
255 0.12
256 0.11
257 0.1
258 0.1
259 0.09
260 0.08
261 0.06
262 0.07
263 0.05
264 0.05
265 0.05
266 0.05
267 0.06
268 0.06
269 0.05
270 0.07
271 0.07
272 0.09
273 0.13
274 0.17
275 0.2
276 0.26
277 0.29
278 0.29
279 0.31
280 0.31
281 0.28
282 0.24
283 0.2
284 0.14
285 0.11
286 0.09
287 0.07
288 0.05
289 0.03
290 0.03
291 0.03
292 0.03
293 0.05
294 0.09
295 0.1
296 0.13
297 0.18
298 0.28
299 0.37
300 0.47
301 0.56
302 0.64
303 0.75
304 0.82
305 0.89
306 0.89
307 0.91
308 0.91
309 0.92
310 0.88
311 0.85
312 0.85
313 0.84