Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NZC4

Protein Details
Accession B8NZC4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-81ASAVRNKTEQRRERKAPRGYVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR005996  Ribosomal_L30_bac-type  
IPR016082  Ribosomal_L30_ferredoxin-like  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ppl:POSPLDRAFT_28528  -  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
CDD cd01658  Ribosomal_L30  
Amino Acid Sequences THYRITLRRSAISLPVRYKGTLVALGLHRRMQTVYHRHTPDIAGKILRVKELVQVENVPASAVRNKTEQRRERKAPRGYVVVGSGLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.42
4 0.4
5 0.38
6 0.31
7 0.26
8 0.21
9 0.18
10 0.17
11 0.19
12 0.22
13 0.23
14 0.23
15 0.21
16 0.2
17 0.2
18 0.19
19 0.24
20 0.29
21 0.34
22 0.4
23 0.41
24 0.41
25 0.41
26 0.4
27 0.37
28 0.31
29 0.26
30 0.18
31 0.17
32 0.2
33 0.2
34 0.18
35 0.14
36 0.12
37 0.15
38 0.18
39 0.19
40 0.16
41 0.17
42 0.17
43 0.16
44 0.16
45 0.11
46 0.07
47 0.09
48 0.12
49 0.13
50 0.14
51 0.2
52 0.25
53 0.34
54 0.44
55 0.51
56 0.57
57 0.65
58 0.73
59 0.78
60 0.83
61 0.83
62 0.81
63 0.78
64 0.74
65 0.67
66 0.6
67 0.51