Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PG50

Protein Details
Accession B8PG50    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
28-60VFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
41-59KMKRNPRKVRWTKAFRKAA
Subcellular Location(s) mito 11.5, mito_nucl 10.833, nucl 9, cyto_nucl 8.333, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
KEGG ppl:POSPLDRAFT_42152  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIDKCYFCSKSVYPGHGTAFVRNDAKVFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAGKEMTIDSTIEFEKRRNVPVRYDRELVQTTVKAMKRISEIKQRREHAFWKNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.42
4 0.42
5 0.42
6 0.36
7 0.33
8 0.32
9 0.3
10 0.27
11 0.26
12 0.22
13 0.23
14 0.23
15 0.23
16 0.22
17 0.25
18 0.25
19 0.33
20 0.4
21 0.46
22 0.49
23 0.56
24 0.61
25 0.67
26 0.77
27 0.78
28 0.81
29 0.82
30 0.86
31 0.88
32 0.9
33 0.87
34 0.9
35 0.88
36 0.87
37 0.86
38 0.85
39 0.83
40 0.84
41 0.82
42 0.73
43 0.72
44 0.64
45 0.62
46 0.55
47 0.46
48 0.37
49 0.32
50 0.3
51 0.22
52 0.21
53 0.13
54 0.11
55 0.11
56 0.11
57 0.1
58 0.1
59 0.17
60 0.19
61 0.26
62 0.31
63 0.33
64 0.41
65 0.5
66 0.57
67 0.55
68 0.56
69 0.5
70 0.49
71 0.49
72 0.41
73 0.36
74 0.28
75 0.25
76 0.3
77 0.3
78 0.27
79 0.25
80 0.27
81 0.3
82 0.35
83 0.4
84 0.44
85 0.51
86 0.58
87 0.67
88 0.69
89 0.69
90 0.7
91 0.7