Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NZD4

Protein Details
Accession B8NZD4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
341-366TAPLVIRKRKPVPSRARPPRVRSAPSHydrophilic
NLS Segment(s)
PositionSequence
255-258PGRR
302-321SSKPRAPVLPAAPRGVRPLR
347-362RKRKPVPSRARPPRVR
Subcellular Location(s) extr 26
Family & Domain DBs
KEGG ppl:POSPLDRAFT_91405  -  
Amino Acid Sequences MFALTGLLVCLLQLFTTIWAWLTSRTRSASEVDIEAVVIAYNPATEHPANQCPISKGNEGSRAGIVDTRHTPEAVSPGDPERYIQEVASATQASPTQCNTIASCSSSTDTFDYPLSPTPPCSSPCPSLDSSIASTPVSSCPGTPQFLPTVCGIAPVGVLGDDVPLPPPADDAHLEDVKVPKCRPLQLPSAAHTLVDDIRPPAPPPADDAEADPFCLSAGSYSADGNWDTTSPADDAGPYSFSIYSSAAKTPRGHPGRRSKSAASSKPASAAISTTPAPSGIHSTPSPASAAPPQGAVKPPPSSKPRAPVLPAAPRGVRPLRLPRGATKPCSIAPPAPLTPTAPLVIRKRKPVPSRARPPRVRSAPSDAPADRRASQLDDLIALVDAAITTGSLDAFAALGSAPHVGALGAGHAGSRVGPAGDVGHNRPRKMQQPICQLDLGEMGAAPRGKARLDLEPDGSGGDVMQCYGLAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.1
5 0.1
6 0.11
7 0.12
8 0.17
9 0.22
10 0.23
11 0.28
12 0.3
13 0.31
14 0.32
15 0.35
16 0.33
17 0.31
18 0.29
19 0.25
20 0.22
21 0.2
22 0.18
23 0.15
24 0.1
25 0.07
26 0.06
27 0.04
28 0.04
29 0.05
30 0.06
31 0.11
32 0.11
33 0.15
34 0.21
35 0.27
36 0.29
37 0.31
38 0.34
39 0.32
40 0.36
41 0.38
42 0.36
43 0.34
44 0.38
45 0.44
46 0.42
47 0.41
48 0.38
49 0.33
50 0.3
51 0.29
52 0.23
53 0.2
54 0.22
55 0.24
56 0.24
57 0.23
58 0.23
59 0.22
60 0.26
61 0.23
62 0.21
63 0.19
64 0.21
65 0.23
66 0.23
67 0.22
68 0.19
69 0.21
70 0.2
71 0.18
72 0.18
73 0.16
74 0.17
75 0.19
76 0.16
77 0.13
78 0.14
79 0.17
80 0.15
81 0.16
82 0.17
83 0.17
84 0.18
85 0.2
86 0.19
87 0.2
88 0.2
89 0.2
90 0.2
91 0.19
92 0.19
93 0.18
94 0.19
95 0.17
96 0.17
97 0.16
98 0.15
99 0.15
100 0.15
101 0.18
102 0.18
103 0.16
104 0.18
105 0.2
106 0.23
107 0.24
108 0.28
109 0.3
110 0.32
111 0.33
112 0.36
113 0.34
114 0.34
115 0.32
116 0.3
117 0.27
118 0.23
119 0.23
120 0.17
121 0.16
122 0.14
123 0.14
124 0.14
125 0.12
126 0.11
127 0.15
128 0.18
129 0.2
130 0.19
131 0.2
132 0.21
133 0.21
134 0.23
135 0.18
136 0.17
137 0.15
138 0.15
139 0.13
140 0.09
141 0.09
142 0.07
143 0.06
144 0.04
145 0.04
146 0.03
147 0.04
148 0.04
149 0.04
150 0.05
151 0.06
152 0.06
153 0.06
154 0.07
155 0.07
156 0.09
157 0.1
158 0.11
159 0.15
160 0.15
161 0.15
162 0.17
163 0.21
164 0.22
165 0.25
166 0.23
167 0.24
168 0.27
169 0.32
170 0.35
171 0.35
172 0.39
173 0.43
174 0.45
175 0.42
176 0.43
177 0.38
178 0.33
179 0.28
180 0.22
181 0.16
182 0.13
183 0.11
184 0.08
185 0.09
186 0.1
187 0.11
188 0.12
189 0.12
190 0.12
191 0.15
192 0.17
193 0.17
194 0.17
195 0.18
196 0.19
197 0.18
198 0.18
199 0.15
200 0.11
201 0.09
202 0.09
203 0.08
204 0.03
205 0.04
206 0.05
207 0.05
208 0.06
209 0.06
210 0.07
211 0.07
212 0.07
213 0.07
214 0.06
215 0.06
216 0.06
217 0.07
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.07
225 0.06
226 0.07
227 0.06
228 0.07
229 0.08
230 0.08
231 0.09
232 0.1
233 0.12
234 0.13
235 0.16
236 0.17
237 0.19
238 0.28
239 0.33
240 0.34
241 0.4
242 0.5
243 0.55
244 0.6
245 0.62
246 0.54
247 0.57
248 0.63
249 0.59
250 0.53
251 0.48
252 0.42
253 0.4
254 0.38
255 0.29
256 0.2
257 0.17
258 0.12
259 0.11
260 0.11
261 0.09
262 0.09
263 0.09
264 0.09
265 0.09
266 0.13
267 0.11
268 0.14
269 0.13
270 0.16
271 0.16
272 0.17
273 0.17
274 0.12
275 0.13
276 0.13
277 0.14
278 0.12
279 0.13
280 0.13
281 0.15
282 0.17
283 0.17
284 0.18
285 0.21
286 0.22
287 0.28
288 0.32
289 0.37
290 0.39
291 0.45
292 0.46
293 0.45
294 0.46
295 0.46
296 0.47
297 0.48
298 0.47
299 0.42
300 0.39
301 0.35
302 0.38
303 0.34
304 0.3
305 0.27
306 0.35
307 0.39
308 0.43
309 0.44
310 0.45
311 0.52
312 0.55
313 0.54
314 0.47
315 0.43
316 0.39
317 0.4
318 0.37
319 0.29
320 0.27
321 0.29
322 0.27
323 0.26
324 0.25
325 0.23
326 0.22
327 0.21
328 0.19
329 0.15
330 0.2
331 0.27
332 0.36
333 0.39
334 0.46
335 0.51
336 0.6
337 0.65
338 0.7
339 0.73
340 0.74
341 0.81
342 0.84
343 0.87
344 0.86
345 0.86
346 0.86
347 0.83
348 0.77
349 0.71
350 0.69
351 0.65
352 0.6
353 0.59
354 0.5
355 0.47
356 0.45
357 0.44
358 0.36
359 0.31
360 0.3
361 0.27
362 0.27
363 0.24
364 0.21
365 0.18
366 0.16
367 0.15
368 0.13
369 0.09
370 0.07
371 0.05
372 0.04
373 0.03
374 0.03
375 0.03
376 0.03
377 0.03
378 0.03
379 0.03
380 0.04
381 0.04
382 0.04
383 0.04
384 0.04
385 0.03
386 0.04
387 0.04
388 0.05
389 0.04
390 0.04
391 0.05
392 0.04
393 0.05
394 0.05
395 0.05
396 0.05
397 0.05
398 0.05
399 0.05
400 0.05
401 0.05
402 0.06
403 0.06
404 0.05
405 0.06
406 0.06
407 0.09
408 0.13
409 0.17
410 0.21
411 0.3
412 0.35
413 0.36
414 0.42
415 0.46
416 0.5
417 0.57
418 0.61
419 0.61
420 0.68
421 0.72
422 0.69
423 0.63
424 0.55
425 0.45
426 0.38
427 0.29
428 0.18
429 0.13
430 0.09
431 0.12
432 0.12
433 0.11
434 0.13
435 0.14
436 0.14
437 0.19
438 0.22
439 0.27
440 0.34
441 0.38
442 0.38
443 0.37
444 0.37
445 0.33
446 0.3
447 0.21
448 0.14
449 0.12
450 0.08
451 0.08
452 0.08