Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421CVU0

Protein Details
Accession A0A421CVU0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-45KVKSATPKVEKQEKKKEPKGRALKRLKYTRRFVBasic
91-114QSHFLSRPRLFRRRKLGDEKGGSDHydrophilic
NLS Segment(s)
PositionSequence
10-40RAGKVKSATPKVEKQEKKKEPKGRALKRLKY
Subcellular Location(s) mito 12, cyto 8.5, cyto_nucl 8, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSATPKVEKQEKKKEPKGRALKRLKYTRRFVNVTMTGGKRKIGVALRTTPFSAWPQILQEVKNQQTLTGAFATDEPQSHFLSRPRLFRRRKLGDEKGGSDDDHRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.41
4 0.43
5 0.46
6 0.54
7 0.58
8 0.66
9 0.7
10 0.71
11 0.75
12 0.78
13 0.82
14 0.84
15 0.85
16 0.82
17 0.85
18 0.86
19 0.84
20 0.85
21 0.85
22 0.84
23 0.84
24 0.86
25 0.85
26 0.83
27 0.8
28 0.78
29 0.75
30 0.69
31 0.61
32 0.59
33 0.51
34 0.45
35 0.43
36 0.36
37 0.31
38 0.29
39 0.28
40 0.19
41 0.17
42 0.19
43 0.18
44 0.19
45 0.2
46 0.25
47 0.26
48 0.26
49 0.26
50 0.22
51 0.2
52 0.18
53 0.17
54 0.12
55 0.11
56 0.11
57 0.15
58 0.16
59 0.15
60 0.18
61 0.23
62 0.25
63 0.28
64 0.26
65 0.23
66 0.23
67 0.23
68 0.21
69 0.15
70 0.13
71 0.1
72 0.1
73 0.12
74 0.11
75 0.11
76 0.11
77 0.13
78 0.15
79 0.16
80 0.19
81 0.21
82 0.3
83 0.34
84 0.41
85 0.47
86 0.56
87 0.63
88 0.69
89 0.75
90 0.75
91 0.8
92 0.81
93 0.82
94 0.82
95 0.81
96 0.76
97 0.7
98 0.62
99 0.54