Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PGW7

Protein Details
Accession B8PGW7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
80-99EDKYRPLKCRKGEGKPKRAGBasic
NLS Segment(s)
PositionSequence
84-98RPLKCRKGEGKPKRA
Subcellular Location(s) mito 13, cyto 7, nucl 5
Family & Domain DBs
KEGG ppl:POSPLDRAFT_98497  -  
Amino Acid Sequences MATWPQEQWNKRSVARALLWSDCSAIDTTMWAHGEDEGIRTVWDVDVDKVLSVESVNLALTGSHVGWREDGEEPRLRVREDKYRPLKCRKGEGKPKRAGGIRLVFTEAMHADTAPGAIDSNASISGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.45
4 0.42
5 0.39
6 0.39
7 0.33
8 0.31
9 0.23
10 0.22
11 0.16
12 0.13
13 0.1
14 0.09
15 0.09
16 0.11
17 0.11
18 0.1
19 0.1
20 0.09
21 0.1
22 0.1
23 0.11
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.07
30 0.08
31 0.07
32 0.07
33 0.08
34 0.09
35 0.08
36 0.08
37 0.08
38 0.07
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.04
50 0.06
51 0.07
52 0.07
53 0.07
54 0.08
55 0.1
56 0.11
57 0.12
58 0.14
59 0.17
60 0.18
61 0.22
62 0.23
63 0.22
64 0.23
65 0.26
66 0.33
67 0.36
68 0.45
69 0.51
70 0.59
71 0.65
72 0.72
73 0.76
74 0.7
75 0.75
76 0.73
77 0.74
78 0.76
79 0.8
80 0.8
81 0.79
82 0.78
83 0.74
84 0.69
85 0.61
86 0.58
87 0.55
88 0.47
89 0.41
90 0.39
91 0.33
92 0.29
93 0.29
94 0.21
95 0.15
96 0.13
97 0.11
98 0.09
99 0.09
100 0.09
101 0.07
102 0.07
103 0.06
104 0.05
105 0.06
106 0.06
107 0.07