Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A229XAN1

Protein Details
Accession A0A229XAN1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
12-39LLWKIPWRISKPQKARQRKRLRAVDRVVHydrophilic
78-99FDKKEKTYRKGIHKLPKWTRVSBasic
NLS Segment(s)
PositionSequence
21-32SKPQKARQRKRL
Subcellular Location(s) mito 25, mito_nucl 13.833, cyto_mito 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPSSPLFSGLLWKIPWRISKPQKARQRKRLRAVDRVVDTLSAALRRNGESTKAVDRWYAEMPREEEMLPKDKYTLFDKKEKTYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.28
4 0.33
5 0.33
6 0.42
7 0.48
8 0.58
9 0.65
10 0.72
11 0.78
12 0.84
13 0.88
14 0.89
15 0.9
16 0.9
17 0.9
18 0.91
19 0.87
20 0.85
21 0.8
22 0.76
23 0.67
24 0.59
25 0.49
26 0.38
27 0.31
28 0.22
29 0.18
30 0.12
31 0.1
32 0.09
33 0.1
34 0.11
35 0.12
36 0.12
37 0.14
38 0.14
39 0.16
40 0.19
41 0.19
42 0.19
43 0.18
44 0.18
45 0.19
46 0.2
47 0.2
48 0.17
49 0.18
50 0.19
51 0.2
52 0.2
53 0.18
54 0.17
55 0.18
56 0.23
57 0.2
58 0.19
59 0.19
60 0.19
61 0.22
62 0.26
63 0.32
64 0.3
65 0.38
66 0.42
67 0.49
68 0.57
69 0.62
70 0.61
71 0.63
72 0.67
73 0.69
74 0.74
75 0.76
76 0.77
77 0.77
78 0.83
79 0.82
80 0.84
81 0.79
82 0.78
83 0.79
84 0.79
85 0.8
86 0.77
87 0.79