Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PEE0

Protein Details
Accession B8PEE0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-43GLSRPQQNGKKRKRAAPEERDKEKKABasic
NLS Segment(s)
PositionSequence
26-47GKKRKRAAPEERDKEKKAAKLK
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007276  Nop14  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0042254  P:ribosome biogenesis  
KEGG ppl:POSPLDRAFT_102624  -  
Pfam View protein in Pfam  
PF04147  Nop14  
Amino Acid Sequences MAKGSQLSQMKAALNQAGLSRPQQNGKKRKRAAPEERDKEKKAAKLKEIQQKLNPFDVKVTKLKHDVGGRKIVGTVGRPAQSKQAGIEQDSVCLTFNARLAEEKNSPEGVRGEGPGRRYRRPPVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.17
5 0.17
6 0.19
7 0.21
8 0.22
9 0.3
10 0.37
11 0.45
12 0.54
13 0.62
14 0.7
15 0.72
16 0.77
17 0.79
18 0.82
19 0.83
20 0.83
21 0.84
22 0.83
23 0.84
24 0.83
25 0.76
26 0.71
27 0.65
28 0.61
29 0.58
30 0.55
31 0.52
32 0.53
33 0.59
34 0.63
35 0.63
36 0.61
37 0.58
38 0.58
39 0.55
40 0.53
41 0.46
42 0.36
43 0.34
44 0.32
45 0.3
46 0.28
47 0.27
48 0.23
49 0.25
50 0.26
51 0.27
52 0.3
53 0.32
54 0.31
55 0.35
56 0.33
57 0.3
58 0.29
59 0.26
60 0.21
61 0.17
62 0.17
63 0.14
64 0.17
65 0.18
66 0.18
67 0.23
68 0.24
69 0.23
70 0.21
71 0.23
72 0.22
73 0.23
74 0.28
75 0.22
76 0.22
77 0.22
78 0.21
79 0.16
80 0.14
81 0.13
82 0.09
83 0.12
84 0.12
85 0.12
86 0.14
87 0.16
88 0.21
89 0.23
90 0.24
91 0.25
92 0.25
93 0.25
94 0.25
95 0.25
96 0.23
97 0.21
98 0.22
99 0.23
100 0.23
101 0.28
102 0.34
103 0.39
104 0.43
105 0.47