Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PA04

Protein Details
Accession B8PA04    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
47-69TLNQSTRRKPLPKSKRPRSPLLEHydrophilic
NLS Segment(s)
PositionSequence
53-66RRKPLPKSKRPRSP
85-99KPKKPNSAKRKVARV
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ppl:POSPLDRAFT_111440  -  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MLSALRSLASPAHRQWPISYLRQSLFQNANVTMLFRSFYPSPPTAVTLNQSTRRKPLPKSKRPRSPLLEGNTQKKGVISSVFIMKPKKPNSAKRKVARVKLTSGKTLHAYIPGEGHNLQEHGVVLVRGGRAQDLPGVRYKLVRGAADFGGVVNRLTARSRYGAKKPKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.37
4 0.39
5 0.41
6 0.43
7 0.39
8 0.38
9 0.43
10 0.42
11 0.43
12 0.41
13 0.37
14 0.35
15 0.31
16 0.31
17 0.25
18 0.25
19 0.18
20 0.15
21 0.12
22 0.09
23 0.13
24 0.13
25 0.16
26 0.21
27 0.21
28 0.23
29 0.24
30 0.27
31 0.23
32 0.23
33 0.23
34 0.22
35 0.27
36 0.34
37 0.36
38 0.36
39 0.4
40 0.46
41 0.49
42 0.51
43 0.56
44 0.59
45 0.66
46 0.75
47 0.8
48 0.83
49 0.83
50 0.84
51 0.79
52 0.75
53 0.72
54 0.66
55 0.65
56 0.58
57 0.58
58 0.52
59 0.46
60 0.39
61 0.31
62 0.26
63 0.18
64 0.15
65 0.11
66 0.09
67 0.13
68 0.14
69 0.16
70 0.18
71 0.19
72 0.26
73 0.28
74 0.36
75 0.39
76 0.48
77 0.56
78 0.65
79 0.72
80 0.7
81 0.78
82 0.76
83 0.77
84 0.75
85 0.68
86 0.64
87 0.62
88 0.58
89 0.53
90 0.46
91 0.41
92 0.34
93 0.33
94 0.27
95 0.23
96 0.21
97 0.16
98 0.17
99 0.16
100 0.16
101 0.14
102 0.15
103 0.12
104 0.12
105 0.11
106 0.1
107 0.1
108 0.08
109 0.08
110 0.07
111 0.06
112 0.08
113 0.08
114 0.08
115 0.08
116 0.09
117 0.09
118 0.09
119 0.14
120 0.13
121 0.15
122 0.2
123 0.22
124 0.22
125 0.23
126 0.24
127 0.25
128 0.27
129 0.27
130 0.23
131 0.24
132 0.24
133 0.23
134 0.22
135 0.17
136 0.15
137 0.14
138 0.12
139 0.09
140 0.1
141 0.1
142 0.13
143 0.15
144 0.16
145 0.21
146 0.29
147 0.35
148 0.45