Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3R7M1E2

Protein Details
Accession A0A3R7M1E2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
125-160MQEPSPSDRTKRKRKTKPRKKPKVHRHTTQPLKISYBasic
NLS Segment(s)
PositionSequence
133-150RTKRKRKTKPRKKPKVHR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MRLWRIHLPSPTYVEPTGSSSPDEIVQSSPTVFPRRVFVHPRMHPEYSGKSIDRLTDFETKPLSESPETLPEVLQESEKTPLQNAIPSKPVVREVPKRFLQLPHGILDELRQQTEQELRERPELMQEPSPSDRTKRKRKTKPRKKPKVHRHTTQPLKISYSVDSSDLQTLRTIRTLVITTNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.31
4 0.29
5 0.24
6 0.23
7 0.19
8 0.2
9 0.2
10 0.2
11 0.15
12 0.14
13 0.14
14 0.14
15 0.14
16 0.15
17 0.17
18 0.21
19 0.22
20 0.21
21 0.25
22 0.29
23 0.35
24 0.39
25 0.42
26 0.48
27 0.52
28 0.59
29 0.6
30 0.57
31 0.52
32 0.5
33 0.47
34 0.42
35 0.41
36 0.33
37 0.29
38 0.28
39 0.29
40 0.26
41 0.23
42 0.23
43 0.27
44 0.27
45 0.27
46 0.28
47 0.25
48 0.25
49 0.24
50 0.24
51 0.15
52 0.17
53 0.17
54 0.21
55 0.21
56 0.2
57 0.19
58 0.15
59 0.17
60 0.16
61 0.14
62 0.09
63 0.1
64 0.12
65 0.13
66 0.13
67 0.11
68 0.12
69 0.12
70 0.15
71 0.16
72 0.15
73 0.16
74 0.17
75 0.17
76 0.16
77 0.18
78 0.17
79 0.22
80 0.29
81 0.32
82 0.38
83 0.4
84 0.42
85 0.41
86 0.4
87 0.39
88 0.36
89 0.33
90 0.27
91 0.25
92 0.22
93 0.2
94 0.2
95 0.2
96 0.16
97 0.14
98 0.13
99 0.12
100 0.14
101 0.19
102 0.2
103 0.18
104 0.22
105 0.24
106 0.26
107 0.27
108 0.26
109 0.28
110 0.29
111 0.27
112 0.28
113 0.26
114 0.29
115 0.31
116 0.34
117 0.28
118 0.31
119 0.37
120 0.43
121 0.53
122 0.59
123 0.67
124 0.76
125 0.86
126 0.92
127 0.94
128 0.96
129 0.96
130 0.97
131 0.97
132 0.97
133 0.97
134 0.97
135 0.95
136 0.92
137 0.91
138 0.91
139 0.9
140 0.86
141 0.8
142 0.72
143 0.67
144 0.6
145 0.52
146 0.43
147 0.36
148 0.3
149 0.26
150 0.24
151 0.22
152 0.25
153 0.23
154 0.22
155 0.21
156 0.22
157 0.22
158 0.23
159 0.22
160 0.16
161 0.2
162 0.21