Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A229YW04

Protein Details
Accession A0A229YW04   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-31IENATTKSRNKNQPLPKKYSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR003746  DUF167  
IPR036591  YggU-like_sf  
Pfam View protein in Pfam  
PF02594  DUF167  
Amino Acid Sequences MSSRAPLLRLIENATTKSRNKNQPLPKKYSLQIACHVKPNASSSREGIIAVGEERVDVCVAAVPRNGEANAAVSRVFAQIFDVPKSNAEVIRGLKSRDKTLCITGLTIEKEGEEQFLKRARQRLEEAIVNNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.35
4 0.43
5 0.48
6 0.53
7 0.58
8 0.65
9 0.72
10 0.77
11 0.82
12 0.81
13 0.77
14 0.73
15 0.67
16 0.67
17 0.61
18 0.54
19 0.55
20 0.54
21 0.51
22 0.52
23 0.5
24 0.41
25 0.38
26 0.38
27 0.36
28 0.3
29 0.3
30 0.24
31 0.26
32 0.25
33 0.23
34 0.19
35 0.12
36 0.1
37 0.09
38 0.07
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.03
46 0.05
47 0.06
48 0.07
49 0.08
50 0.08
51 0.08
52 0.09
53 0.09
54 0.07
55 0.07
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.05
65 0.07
66 0.09
67 0.11
68 0.12
69 0.13
70 0.13
71 0.14
72 0.16
73 0.15
74 0.13
75 0.12
76 0.15
77 0.15
78 0.21
79 0.23
80 0.23
81 0.27
82 0.29
83 0.34
84 0.34
85 0.35
86 0.32
87 0.34
88 0.36
89 0.31
90 0.29
91 0.25
92 0.27
93 0.25
94 0.22
95 0.19
96 0.15
97 0.16
98 0.16
99 0.16
100 0.14
101 0.13
102 0.17
103 0.23
104 0.28
105 0.32
106 0.39
107 0.41
108 0.46
109 0.51
110 0.53
111 0.53
112 0.54