Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PPY3

Protein Details
Accession B8PPY3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-82NVFAYWRRFRRRNRSKRKYDEWIERRHydrophilic
NLS Segment(s)
PositionSequence
64-74RFRRRNRSKRK
Subcellular Location(s) extr 14, mito 9, cyto 1, plas 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ppl:POSPLDRAFT_95866  -  
Amino Acid Sequences MSTSIYIQTTVLPIDGSGGAVSPSSVGPASATSGHPKTPQILGVVFGILGGLLLLLNVFAYWRRFRRRNRSKRKYDEWIERRTFQTPASGEPASTTLATNPQSASTDSLYTTEAYMSESVNSSPYRYGAVARS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.07
5 0.07
6 0.07
7 0.06
8 0.06
9 0.05
10 0.05
11 0.06
12 0.06
13 0.06
14 0.06
15 0.07
16 0.09
17 0.1
18 0.11
19 0.16
20 0.17
21 0.19
22 0.2
23 0.21
24 0.21
25 0.21
26 0.21
27 0.18
28 0.17
29 0.16
30 0.14
31 0.13
32 0.1
33 0.09
34 0.07
35 0.04
36 0.04
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.03
47 0.06
48 0.1
49 0.16
50 0.24
51 0.31
52 0.4
53 0.52
54 0.62
55 0.71
56 0.79
57 0.85
58 0.88
59 0.89
60 0.88
61 0.86
62 0.82
63 0.82
64 0.77
65 0.75
66 0.68
67 0.62
68 0.57
69 0.49
70 0.43
71 0.32
72 0.32
73 0.23
74 0.22
75 0.24
76 0.22
77 0.2
78 0.2
79 0.2
80 0.15
81 0.15
82 0.13
83 0.08
84 0.13
85 0.15
86 0.15
87 0.14
88 0.14
89 0.16
90 0.16
91 0.18
92 0.16
93 0.15
94 0.14
95 0.15
96 0.15
97 0.14
98 0.13
99 0.1
100 0.09
101 0.1
102 0.1
103 0.1
104 0.1
105 0.1
106 0.1
107 0.14
108 0.14
109 0.14
110 0.15
111 0.15
112 0.17
113 0.16