Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PM40

Protein Details
Accession B8PM40    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
68-93RDVPSCPGSRDHRRRRRYTGDREDLEBasic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 8, mito 4, plas 4, pero 3, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013149  ADH-like_C  
IPR011032  GroES-like_sf  
IPR036291  NAD(P)-bd_dom_sf  
KEGG ppl:POSPLDRAFT_89367  -  
Pfam View protein in Pfam  
PF00107  ADH_zinc_N  
Amino Acid Sequences MPSAPHPDTYKAYAFLEKGGDLKPIDVTWRDPQSGEIVVKVLACGVCARHVLVVLEASLYLNCFFPFRDVPSCPGSRDHRRRRRYTGDREDLEGRTTRRRRLARWALLDMLWLSGRQFPPVLLPTAVASVPEDIDPAEVAPLMCAGVSVYTALRDMNAHAPDVIGIHGMGGLGHLAVQFAKAMGFRPVVLSSTSEKEELAFKFGAYKFLDGSKVNQAEELAKLGGAKVILCLAPDDNVVQSLVNGLAPGGEFFILAVSQGGTVPLGLFVGKRLNLRTGGAGTAKEEEETIDFVRAHDIKVLVNKFPLAEAQKAYEHRSAARFRSVIIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.28
4 0.24
5 0.23
6 0.21
7 0.23
8 0.19
9 0.19
10 0.18
11 0.16
12 0.2
13 0.2
14 0.23
15 0.28
16 0.33
17 0.33
18 0.31
19 0.32
20 0.31
21 0.34
22 0.29
23 0.22
24 0.18
25 0.17
26 0.17
27 0.15
28 0.14
29 0.09
30 0.09
31 0.1
32 0.1
33 0.12
34 0.13
35 0.13
36 0.12
37 0.13
38 0.13
39 0.12
40 0.12
41 0.1
42 0.09
43 0.08
44 0.08
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.12
53 0.14
54 0.18
55 0.23
56 0.24
57 0.28
58 0.33
59 0.35
60 0.32
61 0.36
62 0.4
63 0.45
64 0.54
65 0.62
66 0.66
67 0.75
68 0.81
69 0.84
70 0.87
71 0.86
72 0.87
73 0.86
74 0.85
75 0.77
76 0.73
77 0.68
78 0.58
79 0.5
80 0.43
81 0.34
82 0.35
83 0.38
84 0.39
85 0.44
86 0.49
87 0.5
88 0.57
89 0.65
90 0.63
91 0.64
92 0.61
93 0.53
94 0.48
95 0.45
96 0.34
97 0.24
98 0.16
99 0.11
100 0.09
101 0.12
102 0.12
103 0.12
104 0.12
105 0.11
106 0.14
107 0.16
108 0.17
109 0.12
110 0.12
111 0.12
112 0.13
113 0.13
114 0.09
115 0.08
116 0.07
117 0.07
118 0.06
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.06
143 0.1
144 0.11
145 0.11
146 0.11
147 0.11
148 0.1
149 0.1
150 0.09
151 0.04
152 0.04
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.02
159 0.02
160 0.02
161 0.02
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.04
168 0.04
169 0.05
170 0.07
171 0.07
172 0.07
173 0.09
174 0.09
175 0.1
176 0.1
177 0.12
178 0.12
179 0.14
180 0.15
181 0.14
182 0.13
183 0.13
184 0.17
185 0.15
186 0.16
187 0.14
188 0.12
189 0.18
190 0.19
191 0.23
192 0.2
193 0.2
194 0.17
195 0.19
196 0.22
197 0.16
198 0.19
199 0.22
200 0.23
201 0.22
202 0.22
203 0.21
204 0.19
205 0.19
206 0.18
207 0.1
208 0.08
209 0.08
210 0.08
211 0.08
212 0.07
213 0.06
214 0.05
215 0.06
216 0.06
217 0.07
218 0.07
219 0.07
220 0.07
221 0.08
222 0.08
223 0.07
224 0.08
225 0.08
226 0.07
227 0.06
228 0.06
229 0.06
230 0.06
231 0.05
232 0.04
233 0.04
234 0.05
235 0.05
236 0.05
237 0.04
238 0.04
239 0.04
240 0.05
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.05
247 0.05
248 0.04
249 0.05
250 0.05
251 0.04
252 0.04
253 0.05
254 0.05
255 0.06
256 0.11
257 0.13
258 0.16
259 0.18
260 0.21
261 0.23
262 0.24
263 0.25
264 0.22
265 0.23
266 0.22
267 0.2
268 0.18
269 0.19
270 0.18
271 0.16
272 0.14
273 0.13
274 0.12
275 0.14
276 0.14
277 0.15
278 0.14
279 0.14
280 0.22
281 0.21
282 0.2
283 0.21
284 0.21
285 0.21
286 0.29
287 0.32
288 0.27
289 0.28
290 0.28
291 0.25
292 0.24
293 0.28
294 0.24
295 0.25
296 0.25
297 0.26
298 0.32
299 0.34
300 0.39
301 0.37
302 0.35
303 0.36
304 0.41
305 0.44
306 0.43
307 0.48
308 0.43