Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PBG8

Protein Details
Accession B8PBG8    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-87LSNPGYRYKPEHKKTGRPPKBasic
NLS Segment(s)
PositionSequence
75-87YKPEHKKTGRPPK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG ppl:POSPLDRAFT_28446  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences KDPNHIPRPSNCFILYKNDYIRRLYESGYEAMSKDITKVIGAQWRLLPENERRYWKDKAKEVKDDHRLSNPGYRYKPEHKKTGRPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.39
4 0.43
5 0.45
6 0.46
7 0.45
8 0.45
9 0.4
10 0.37
11 0.33
12 0.28
13 0.24
14 0.23
15 0.21
16 0.2
17 0.15
18 0.14
19 0.14
20 0.11
21 0.09
22 0.09
23 0.08
24 0.07
25 0.08
26 0.09
27 0.13
28 0.13
29 0.14
30 0.14
31 0.15
32 0.16
33 0.16
34 0.17
35 0.19
36 0.27
37 0.29
38 0.34
39 0.36
40 0.4
41 0.48
42 0.52
43 0.53
44 0.54
45 0.61
46 0.62
47 0.68
48 0.69
49 0.71
50 0.73
51 0.7
52 0.65
53 0.61
54 0.56
55 0.5
56 0.51
57 0.46
58 0.45
59 0.44
60 0.46
61 0.47
62 0.55
63 0.64
64 0.63
65 0.68
66 0.68
67 0.76