Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A229XMX8

Protein Details
Accession A0A229XMX8    Localization Confidence High Confidence Score 22.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-32VEAPSQFKQPSRKGKKAWRKNVDVTEVQHydrophilic
269-307YEKPEWLNKKRPARKTKAERNKIKRRKEAERKARWEAKMBasic
396-425GKLESRKPVTQAKKAKRKLTEKWTYKDFKIHydrophilic
NLS Segment(s)
PositionSequence
16-22RKGKKAW
276-308NKKRPARKTKAERNKIKRRKEAERKARWEAKMK
407-413AKKAKRK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MSATVEAPSQFKQPSRKGKKAWRKNVDVTEVQEGLRLLKDEEIKGGVLAEKPSEELFVIDKKGSAEIRNAYLKQHKPLKADEILAQRSAIPAVDTRKRLNSKVTDGVIEPKSKRHKSDWVTRKEWLRLKQVAKEANPTQKAEESEPYDPWADAEDPTPVEDPQFDYLEKPKPKVAPPTLKKPPISLAANGKPIPSVRTPDAGISYNPSFEDWDRLLQEKGQEAVEAEKKRLEEERKEQERQRLIAEAQNDDGEVKSDDESAWEGFESEYEKPEWLNKKRPARKTKAERNKIKRRKEAERKARWEAKMKQKEEQLEQAKALAEQVQQRQLERSQESEDDSSEEGDDVALRRRPLGKTRVPEKPLEVVLPDELQDSLRLLKPEGNLLDDRFRTLIVQGKLESRKPVTQAKKAKRKLTEKWTYKDFKIPGLEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.63
3 0.7
4 0.75
5 0.83
6 0.88
7 0.9
8 0.92
9 0.9
10 0.89
11 0.89
12 0.88
13 0.84
14 0.77
15 0.69
16 0.64
17 0.55
18 0.46
19 0.39
20 0.31
21 0.25
22 0.22
23 0.19
24 0.14
25 0.18
26 0.22
27 0.2
28 0.22
29 0.22
30 0.21
31 0.2
32 0.2
33 0.17
34 0.15
35 0.16
36 0.14
37 0.13
38 0.14
39 0.14
40 0.14
41 0.12
42 0.11
43 0.13
44 0.15
45 0.17
46 0.16
47 0.17
48 0.17
49 0.21
50 0.22
51 0.21
52 0.24
53 0.25
54 0.3
55 0.35
56 0.35
57 0.36
58 0.43
59 0.46
60 0.49
61 0.55
62 0.55
63 0.52
64 0.56
65 0.57
66 0.52
67 0.5
68 0.47
69 0.46
70 0.43
71 0.4
72 0.35
73 0.28
74 0.25
75 0.23
76 0.17
77 0.1
78 0.11
79 0.17
80 0.24
81 0.27
82 0.3
83 0.38
84 0.42
85 0.44
86 0.49
87 0.48
88 0.48
89 0.52
90 0.5
91 0.43
92 0.39
93 0.44
94 0.39
95 0.38
96 0.32
97 0.33
98 0.42
99 0.45
100 0.48
101 0.47
102 0.54
103 0.55
104 0.66
105 0.68
106 0.67
107 0.66
108 0.66
109 0.67
110 0.65
111 0.65
112 0.6
113 0.59
114 0.58
115 0.58
116 0.59
117 0.6
118 0.58
119 0.53
120 0.54
121 0.51
122 0.51
123 0.51
124 0.45
125 0.41
126 0.38
127 0.38
128 0.34
129 0.33
130 0.29
131 0.28
132 0.27
133 0.27
134 0.24
135 0.22
136 0.19
137 0.16
138 0.12
139 0.11
140 0.11
141 0.11
142 0.1
143 0.11
144 0.12
145 0.1
146 0.09
147 0.09
148 0.11
149 0.12
150 0.13
151 0.12
152 0.13
153 0.17
154 0.25
155 0.27
156 0.27
157 0.28
158 0.31
159 0.35
160 0.42
161 0.47
162 0.49
163 0.52
164 0.6
165 0.65
166 0.66
167 0.63
168 0.55
169 0.5
170 0.45
171 0.43
172 0.36
173 0.35
174 0.33
175 0.37
176 0.36
177 0.32
178 0.26
179 0.25
180 0.24
181 0.18
182 0.18
183 0.16
184 0.17
185 0.18
186 0.18
187 0.2
188 0.18
189 0.16
190 0.16
191 0.15
192 0.13
193 0.13
194 0.12
195 0.11
196 0.1
197 0.14
198 0.11
199 0.13
200 0.13
201 0.15
202 0.14
203 0.14
204 0.15
205 0.13
206 0.13
207 0.11
208 0.1
209 0.09
210 0.12
211 0.17
212 0.17
213 0.16
214 0.17
215 0.17
216 0.18
217 0.24
218 0.26
219 0.26
220 0.34
221 0.44
222 0.49
223 0.54
224 0.56
225 0.58
226 0.57
227 0.52
228 0.45
229 0.37
230 0.32
231 0.3
232 0.27
233 0.21
234 0.17
235 0.15
236 0.14
237 0.11
238 0.1
239 0.08
240 0.07
241 0.07
242 0.07
243 0.07
244 0.07
245 0.08
246 0.09
247 0.08
248 0.08
249 0.07
250 0.07
251 0.06
252 0.07
253 0.09
254 0.08
255 0.09
256 0.1
257 0.1
258 0.1
259 0.17
260 0.26
261 0.3
262 0.39
263 0.46
264 0.56
265 0.65
266 0.75
267 0.79
268 0.79
269 0.83
270 0.84
271 0.87
272 0.88
273 0.89
274 0.9
275 0.9
276 0.92
277 0.92
278 0.91
279 0.89
280 0.86
281 0.86
282 0.87
283 0.87
284 0.87
285 0.88
286 0.85
287 0.85
288 0.85
289 0.78
290 0.76
291 0.74
292 0.74
293 0.74
294 0.69
295 0.65
296 0.63
297 0.64
298 0.58
299 0.59
300 0.53
301 0.45
302 0.43
303 0.39
304 0.34
305 0.28
306 0.25
307 0.18
308 0.16
309 0.19
310 0.23
311 0.28
312 0.28
313 0.29
314 0.32
315 0.32
316 0.36
317 0.32
318 0.32
319 0.29
320 0.3
321 0.32
322 0.3
323 0.27
324 0.23
325 0.21
326 0.19
327 0.15
328 0.14
329 0.1
330 0.09
331 0.09
332 0.08
333 0.13
334 0.16
335 0.16
336 0.19
337 0.24
338 0.29
339 0.36
340 0.44
341 0.46
342 0.53
343 0.6
344 0.67
345 0.65
346 0.64
347 0.6
348 0.56
349 0.5
350 0.42
351 0.35
352 0.28
353 0.26
354 0.23
355 0.19
356 0.15
357 0.13
358 0.12
359 0.11
360 0.11
361 0.13
362 0.15
363 0.16
364 0.17
365 0.2
366 0.21
367 0.27
368 0.27
369 0.28
370 0.27
371 0.29
372 0.36
373 0.32
374 0.33
375 0.27
376 0.26
377 0.22
378 0.23
379 0.28
380 0.23
381 0.26
382 0.25
383 0.33
384 0.38
385 0.41
386 0.44
387 0.42
388 0.44
389 0.46
390 0.54
391 0.55
392 0.6
393 0.68
394 0.72
395 0.78
396 0.82
397 0.85
398 0.85
399 0.86
400 0.86
401 0.86
402 0.86
403 0.85
404 0.83
405 0.84
406 0.81
407 0.75
408 0.74
409 0.65
410 0.61