Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PLV5

Protein Details
Accession B8PLV5   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
131-154SEWKIAGMTRRRRWTRRVYYDPSVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010482  Peroxin  
Gene Ontology GO:0005778  C:peroxisomal membrane  
GO:0007031  P:peroxisome organization  
KEGG ppl:POSPLDRAFT_101492  -  
Pfam View protein in Pfam  
PF06398  Pex24p  
Amino Acid Sequences MSRLSRISWARYDRHWRAELREVELFENERWNVGTGTGAEDDGEWAKSHLKPGERKAWTRGRDGWSGVDEDGASDVSSKLTFALEPGWAFVETEDWRPDVEGEWAVPANADDAGWVYTNDSWLDPRPLPLSEWKIAGMTRRRRWTRRVYYDPSVATQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.57
4 0.58
5 0.63
6 0.58
7 0.54
8 0.5
9 0.44
10 0.4
11 0.39
12 0.35
13 0.26
14 0.28
15 0.22
16 0.19
17 0.18
18 0.18
19 0.16
20 0.14
21 0.14
22 0.09
23 0.12
24 0.12
25 0.11
26 0.09
27 0.09
28 0.1
29 0.09
30 0.1
31 0.07
32 0.07
33 0.11
34 0.11
35 0.16
36 0.18
37 0.24
38 0.29
39 0.35
40 0.44
41 0.46
42 0.48
43 0.51
44 0.56
45 0.53
46 0.52
47 0.52
48 0.46
49 0.44
50 0.43
51 0.37
52 0.29
53 0.27
54 0.22
55 0.16
56 0.12
57 0.09
58 0.08
59 0.06
60 0.05
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.06
72 0.06
73 0.06
74 0.07
75 0.07
76 0.07
77 0.07
78 0.09
79 0.09
80 0.12
81 0.12
82 0.11
83 0.11
84 0.12
85 0.12
86 0.1
87 0.1
88 0.08
89 0.08
90 0.09
91 0.09
92 0.08
93 0.08
94 0.07
95 0.06
96 0.05
97 0.05
98 0.04
99 0.05
100 0.06
101 0.06
102 0.06
103 0.07
104 0.07
105 0.09
106 0.09
107 0.09
108 0.1
109 0.12
110 0.17
111 0.17
112 0.19
113 0.21
114 0.21
115 0.23
116 0.29
117 0.32
118 0.29
119 0.3
120 0.28
121 0.27
122 0.27
123 0.33
124 0.35
125 0.39
126 0.46
127 0.56
128 0.64
129 0.69
130 0.77
131 0.8
132 0.82
133 0.82
134 0.83
135 0.81
136 0.79
137 0.8