Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PK20

Protein Details
Accession B8PK20    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-50GTEYQPSQRKRKRKHGFLARKRSVSHydrophilic
NLS Segment(s)
PositionSequence
34-65RKRKRKHGFLARKRSVSGQKILVRRRAKGRRF
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ppl:POSPLDRAFT_38293  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences PFSLLKLTTTSPILSVVQQVRFRSRGTEYQPSQRKRKRKHGFLARKRSVSGQKILVRRRAKGRRFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.2
3 0.21
4 0.25
5 0.28
6 0.3
7 0.32
8 0.33
9 0.32
10 0.3
11 0.3
12 0.31
13 0.33
14 0.41
15 0.39
16 0.47
17 0.55
18 0.57
19 0.64
20 0.64
21 0.68
22 0.67
23 0.76
24 0.76
25 0.77
26 0.82
27 0.83
28 0.88
29 0.88
30 0.91
31 0.86
32 0.78
33 0.7
34 0.66
35 0.63
36 0.57
37 0.51
38 0.48
39 0.48
40 0.54
41 0.59
42 0.62
43 0.58
44 0.59
45 0.65
46 0.67
47 0.69
48 0.71