Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421DF23

Protein Details
Accession A0A421DF23   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
327-347FATPEKPKRQVRPQEERHFGWHydrophilic
482-501SKTAPPPQRRAMRHVNEKHWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9.5, cyto_mito 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032710  NTF2-like_dom_sf  
Amino Acid Sequences MSLKDLYQRFLANPKSVPLAANASLIYITTATQFDGADAIVGHLTKQETVVKKKAAEIIGAIEGSDSLCLDVEVTLEFVSGGGAYLPSLDDNFLADRVATFPTVHIVRFDSEKQIQNVRIYWDQASLLKQVDVIGARGRSWPIRDAKDQTRLIKAAVASTPAGEAPATKVPASSQPSRKENGDESRPLSPSKRHIKDPYAAESLEELLSPGKDRAQPVRAPRAPASAKPPPRDYSELFVGEDENDSPEATPSKPRVIAPKVGAGKNFRASRIFEDDESEAKQQIAYKTNPKRFDHFEIGADNGQREVKSKPGRPMSRHIPHWDFEDFATPEKPKRQVRPQEERHFGWSDDEVQPTPVVKPHVPQPRPDAETHFHLADNDEDERKSRIISSFQNKGLNLYKTHMYNEEESPGKNAAEKAPLSMVPNGGNRKKDFESHWSMAGSSPADGKVSHENEKPMATDRLKAVKMMESSWEAYDESPQPSKTAPPPQRRAMRHVNEKHWGFGDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.37
4 0.35
5 0.3
6 0.3
7 0.26
8 0.26
9 0.24
10 0.19
11 0.18
12 0.17
13 0.15
14 0.09
15 0.08
16 0.08
17 0.09
18 0.09
19 0.1
20 0.1
21 0.09
22 0.1
23 0.09
24 0.08
25 0.07
26 0.08
27 0.08
28 0.08
29 0.08
30 0.1
31 0.11
32 0.1
33 0.13
34 0.2
35 0.26
36 0.34
37 0.41
38 0.43
39 0.44
40 0.47
41 0.51
42 0.46
43 0.39
44 0.33
45 0.29
46 0.26
47 0.25
48 0.2
49 0.14
50 0.12
51 0.11
52 0.1
53 0.06
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.06
64 0.06
65 0.05
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.06
76 0.06
77 0.06
78 0.07
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.1
86 0.1
87 0.09
88 0.09
89 0.14
90 0.15
91 0.15
92 0.15
93 0.16
94 0.16
95 0.2
96 0.22
97 0.23
98 0.28
99 0.33
100 0.34
101 0.39
102 0.41
103 0.4
104 0.4
105 0.39
106 0.36
107 0.33
108 0.3
109 0.26
110 0.24
111 0.23
112 0.23
113 0.2
114 0.18
115 0.16
116 0.15
117 0.14
118 0.14
119 0.13
120 0.12
121 0.13
122 0.13
123 0.13
124 0.15
125 0.17
126 0.17
127 0.18
128 0.24
129 0.27
130 0.32
131 0.36
132 0.42
133 0.46
134 0.53
135 0.56
136 0.53
137 0.51
138 0.46
139 0.41
140 0.37
141 0.31
142 0.24
143 0.2
144 0.19
145 0.14
146 0.13
147 0.13
148 0.1
149 0.1
150 0.07
151 0.07
152 0.08
153 0.11
154 0.12
155 0.12
156 0.12
157 0.13
158 0.2
159 0.25
160 0.3
161 0.34
162 0.4
163 0.44
164 0.46
165 0.47
166 0.44
167 0.45
168 0.45
169 0.43
170 0.39
171 0.38
172 0.4
173 0.39
174 0.37
175 0.34
176 0.31
177 0.34
178 0.41
179 0.42
180 0.45
181 0.5
182 0.53
183 0.57
184 0.57
185 0.54
186 0.46
187 0.41
188 0.35
189 0.29
190 0.25
191 0.19
192 0.14
193 0.08
194 0.06
195 0.06
196 0.07
197 0.07
198 0.09
199 0.11
200 0.13
201 0.18
202 0.22
203 0.26
204 0.31
205 0.41
206 0.41
207 0.42
208 0.41
209 0.43
210 0.4
211 0.39
212 0.4
213 0.38
214 0.42
215 0.42
216 0.45
217 0.4
218 0.43
219 0.45
220 0.39
221 0.35
222 0.33
223 0.31
224 0.27
225 0.24
226 0.2
227 0.16
228 0.14
229 0.1
230 0.07
231 0.06
232 0.06
233 0.06
234 0.06
235 0.07
236 0.07
237 0.11
238 0.12
239 0.15
240 0.16
241 0.18
242 0.24
243 0.26
244 0.3
245 0.28
246 0.33
247 0.34
248 0.34
249 0.35
250 0.3
251 0.3
252 0.32
253 0.32
254 0.26
255 0.24
256 0.24
257 0.26
258 0.3
259 0.28
260 0.22
261 0.23
262 0.23
263 0.23
264 0.23
265 0.2
266 0.14
267 0.12
268 0.13
269 0.13
270 0.15
271 0.19
272 0.19
273 0.28
274 0.37
275 0.44
276 0.5
277 0.5
278 0.51
279 0.52
280 0.56
281 0.53
282 0.46
283 0.41
284 0.35
285 0.34
286 0.31
287 0.26
288 0.19
289 0.14
290 0.13
291 0.11
292 0.12
293 0.11
294 0.18
295 0.25
296 0.29
297 0.36
298 0.45
299 0.52
300 0.54
301 0.61
302 0.63
303 0.63
304 0.63
305 0.62
306 0.55
307 0.5
308 0.49
309 0.42
310 0.33
311 0.26
312 0.28
313 0.21
314 0.2
315 0.22
316 0.19
317 0.22
318 0.27
319 0.34
320 0.35
321 0.43
322 0.51
323 0.59
324 0.67
325 0.75
326 0.8
327 0.82
328 0.81
329 0.74
330 0.69
331 0.61
332 0.51
333 0.43
334 0.34
335 0.29
336 0.25
337 0.25
338 0.2
339 0.18
340 0.19
341 0.17
342 0.17
343 0.15
344 0.16
345 0.15
346 0.17
347 0.24
348 0.35
349 0.35
350 0.38
351 0.43
352 0.46
353 0.49
354 0.49
355 0.46
356 0.39
357 0.43
358 0.42
359 0.36
360 0.28
361 0.25
362 0.25
363 0.2
364 0.2
365 0.17
366 0.16
367 0.15
368 0.17
369 0.19
370 0.18
371 0.17
372 0.17
373 0.17
374 0.21
375 0.3
376 0.35
377 0.4
378 0.44
379 0.48
380 0.45
381 0.47
382 0.48
383 0.43
384 0.37
385 0.33
386 0.33
387 0.3
388 0.32
389 0.32
390 0.28
391 0.28
392 0.28
393 0.3
394 0.28
395 0.26
396 0.27
397 0.25
398 0.22
399 0.21
400 0.21
401 0.19
402 0.23
403 0.23
404 0.22
405 0.23
406 0.24
407 0.24
408 0.24
409 0.23
410 0.21
411 0.27
412 0.34
413 0.36
414 0.41
415 0.4
416 0.44
417 0.45
418 0.46
419 0.45
420 0.45
421 0.49
422 0.46
423 0.47
424 0.42
425 0.4
426 0.35
427 0.33
428 0.25
429 0.16
430 0.16
431 0.13
432 0.14
433 0.13
434 0.16
435 0.22
436 0.26
437 0.31
438 0.33
439 0.36
440 0.37
441 0.38
442 0.37
443 0.33
444 0.36
445 0.32
446 0.33
447 0.35
448 0.41
449 0.4
450 0.4
451 0.37
452 0.35
453 0.35
454 0.32
455 0.31
456 0.26
457 0.28
458 0.27
459 0.26
460 0.21
461 0.19
462 0.24
463 0.23
464 0.25
465 0.27
466 0.27
467 0.27
468 0.27
469 0.33
470 0.36
471 0.43
472 0.48
473 0.54
474 0.62
475 0.71
476 0.79
477 0.78
478 0.78
479 0.79
480 0.79
481 0.79
482 0.8
483 0.78
484 0.78
485 0.75
486 0.7
487 0.62