Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421DAR4

Protein Details
Accession A0A421DAR4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
156-179NLGSTLRGKKRGKRKRDDMDRDELBasic
NLS Segment(s)
PositionSequence
158-171GSTLRGKKRGKRKR
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR027417  P-loop_NTPase  
IPR014014  RNA_helicase_DEAD_Q_motif  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016787  F:hydrolase activity  
GO:0003676  F:nucleic acid binding  
GO:0003724  F:RNA helicase activity  
Pfam View protein in Pfam  
PF00270  DEAD  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
PS51195  Q_MOTIF  
Amino Acid Sequences MSSPKTKVISPRSEISSNPSNHPASLPEQVEAHSSDEDAPKNFRDLGLLESLCEACDSLGYRTPTPIQALSIPVALQGRDLIGLAETGSGKTAAFVLPILQALLESPQALHSLILAPTRELALQISQVVEAFAERVGEAQKVAAVGMKDLRDKRGNLGSTLRGKKRGKRKRDDMDRDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.5
3 0.5
4 0.44
5 0.43
6 0.43
7 0.38
8 0.36
9 0.37
10 0.33
11 0.28
12 0.32
13 0.29
14 0.24
15 0.24
16 0.24
17 0.25
18 0.23
19 0.21
20 0.14
21 0.13
22 0.14
23 0.17
24 0.19
25 0.19
26 0.2
27 0.18
28 0.2
29 0.2
30 0.18
31 0.16
32 0.15
33 0.16
34 0.19
35 0.18
36 0.16
37 0.16
38 0.16
39 0.14
40 0.13
41 0.11
42 0.05
43 0.06
44 0.08
45 0.08
46 0.14
47 0.16
48 0.16
49 0.18
50 0.19
51 0.2
52 0.2
53 0.19
54 0.15
55 0.13
56 0.15
57 0.14
58 0.13
59 0.11
60 0.1
61 0.1
62 0.09
63 0.08
64 0.06
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.03
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.05
91 0.04
92 0.04
93 0.04
94 0.05
95 0.06
96 0.06
97 0.06
98 0.05
99 0.07
100 0.08
101 0.09
102 0.09
103 0.09
104 0.09
105 0.09
106 0.09
107 0.08
108 0.08
109 0.07
110 0.07
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.06
117 0.05
118 0.05
119 0.04
120 0.04
121 0.04
122 0.05
123 0.06
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.08
131 0.08
132 0.09
133 0.12
134 0.14
135 0.2
136 0.22
137 0.28
138 0.31
139 0.32
140 0.37
141 0.42
142 0.41
143 0.38
144 0.42
145 0.43
146 0.48
147 0.56
148 0.55
149 0.56
150 0.61
151 0.66
152 0.72
153 0.76
154 0.77
155 0.79
156 0.85
157 0.86
158 0.91
159 0.93