Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421D8M1

Protein Details
Accession A0A421D8M1   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-61VDSRRKRHAISQKNQRDRLKBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MSPSPPSSFSTTAARPPPRFIELRPKGEGVLITFPEGGAPQVDSRRKRHAISQKNQRDRLKAALEQMARVLHAGGLGSGSSAGSGLRGPSGTKVRGLNSYRVELIETAVEYIQSLEKEVKMLRSSVKEAPLPLPHEGANGRKPTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.48
4 0.5
5 0.48
6 0.48
7 0.45
8 0.48
9 0.48
10 0.52
11 0.51
12 0.46
13 0.42
14 0.41
15 0.38
16 0.29
17 0.25
18 0.19
19 0.18
20 0.17
21 0.16
22 0.15
23 0.14
24 0.11
25 0.07
26 0.07
27 0.08
28 0.15
29 0.22
30 0.27
31 0.31
32 0.4
33 0.43
34 0.44
35 0.51
36 0.54
37 0.58
38 0.63
39 0.7
40 0.71
41 0.77
42 0.83
43 0.77
44 0.71
45 0.63
46 0.59
47 0.52
48 0.44
49 0.38
50 0.35
51 0.32
52 0.28
53 0.26
54 0.2
55 0.16
56 0.14
57 0.11
58 0.05
59 0.05
60 0.05
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.02
68 0.03
69 0.02
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.05
76 0.09
77 0.13
78 0.14
79 0.17
80 0.19
81 0.2
82 0.28
83 0.3
84 0.33
85 0.32
86 0.33
87 0.31
88 0.29
89 0.28
90 0.2
91 0.18
92 0.13
93 0.1
94 0.09
95 0.08
96 0.08
97 0.07
98 0.07
99 0.08
100 0.07
101 0.09
102 0.1
103 0.1
104 0.13
105 0.14
106 0.18
107 0.17
108 0.2
109 0.23
110 0.26
111 0.31
112 0.33
113 0.37
114 0.34
115 0.35
116 0.38
117 0.39
118 0.38
119 0.35
120 0.33
121 0.28
122 0.3
123 0.31
124 0.32
125 0.34