Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PL70

Protein Details
Accession B8PL70    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
109-132PSSGRPTTLHRKRTSRRRDAPSAQHydrophilic
NLS Segment(s)
PositionSequence
257-283RDRLRGLLKRAAPRGQERARKLGRASS
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 9, cyto 6.5
Family & Domain DBs
KEGG ppl:POSPLDRAFT_101866  -  
Amino Acid Sequences MSNTIVPHPQLTVPAQPGLQHQRYQLITWKIEGYNGGQDPGEEPQQPLWTVMVLSSLPPSPPLREQGDALTILETREPSDAQINDPSRSLDHDMLDPPSDRGPERGVVPSSGRPTTLHRKRTSRRRDAPSAQLNTQGSSSSASPDPVMQELRRSVRTTLFHADIQNRFHKKSETIDSRQRHAVQASGHIIRTTGQASGEVNAVANRSRQSASHAMPTSGPGTDDVGQDNLRQTPCLDMPDLNEPRVEDSENVGRMPRDRLRGLLKRAAPRGQERARKLGRASSRGPEAPIVVYNDRARLSLPFGFPADLVADSGVAEGTMSCSCSRVGFTSEGNPEPMQVEASCSHVTKMMPYIIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.26
4 0.33
5 0.39
6 0.4
7 0.38
8 0.37
9 0.42
10 0.43
11 0.44
12 0.44
13 0.42
14 0.39
15 0.38
16 0.4
17 0.33
18 0.33
19 0.32
20 0.26
21 0.27
22 0.26
23 0.25
24 0.2
25 0.2
26 0.21
27 0.22
28 0.23
29 0.16
30 0.17
31 0.19
32 0.23
33 0.23
34 0.22
35 0.19
36 0.16
37 0.15
38 0.13
39 0.12
40 0.09
41 0.09
42 0.1
43 0.11
44 0.1
45 0.13
46 0.15
47 0.17
48 0.2
49 0.25
50 0.28
51 0.28
52 0.3
53 0.29
54 0.3
55 0.26
56 0.23
57 0.19
58 0.15
59 0.14
60 0.14
61 0.11
62 0.1
63 0.11
64 0.1
65 0.11
66 0.17
67 0.17
68 0.18
69 0.26
70 0.28
71 0.27
72 0.28
73 0.27
74 0.22
75 0.25
76 0.26
77 0.21
78 0.19
79 0.21
80 0.22
81 0.22
82 0.24
83 0.21
84 0.18
85 0.17
86 0.18
87 0.16
88 0.16
89 0.17
90 0.17
91 0.18
92 0.21
93 0.2
94 0.2
95 0.22
96 0.25
97 0.26
98 0.25
99 0.23
100 0.21
101 0.26
102 0.36
103 0.42
104 0.46
105 0.49
106 0.59
107 0.68
108 0.77
109 0.81
110 0.81
111 0.82
112 0.82
113 0.84
114 0.8
115 0.8
116 0.78
117 0.72
118 0.61
119 0.57
120 0.49
121 0.4
122 0.35
123 0.26
124 0.17
125 0.14
126 0.13
127 0.1
128 0.1
129 0.1
130 0.1
131 0.11
132 0.11
133 0.11
134 0.13
135 0.11
136 0.13
137 0.17
138 0.2
139 0.22
140 0.22
141 0.22
142 0.25
143 0.27
144 0.28
145 0.29
146 0.28
147 0.27
148 0.28
149 0.31
150 0.28
151 0.3
152 0.34
153 0.32
154 0.31
155 0.31
156 0.3
157 0.28
158 0.3
159 0.35
160 0.35
161 0.38
162 0.46
163 0.47
164 0.48
165 0.5
166 0.46
167 0.39
168 0.31
169 0.28
170 0.2
171 0.21
172 0.22
173 0.19
174 0.18
175 0.16
176 0.16
177 0.14
178 0.14
179 0.11
180 0.08
181 0.07
182 0.08
183 0.08
184 0.09
185 0.09
186 0.07
187 0.07
188 0.06
189 0.07
190 0.07
191 0.08
192 0.08
193 0.1
194 0.1
195 0.1
196 0.16
197 0.21
198 0.22
199 0.28
200 0.28
201 0.27
202 0.26
203 0.28
204 0.23
205 0.17
206 0.16
207 0.09
208 0.11
209 0.12
210 0.12
211 0.11
212 0.12
213 0.12
214 0.13
215 0.14
216 0.15
217 0.14
218 0.13
219 0.13
220 0.15
221 0.16
222 0.17
223 0.17
224 0.14
225 0.16
226 0.25
227 0.27
228 0.24
229 0.23
230 0.21
231 0.23
232 0.23
233 0.22
234 0.13
235 0.15
236 0.2
237 0.2
238 0.2
239 0.19
240 0.18
241 0.19
242 0.25
243 0.26
244 0.27
245 0.27
246 0.31
247 0.39
248 0.46
249 0.5
250 0.51
251 0.52
252 0.54
253 0.58
254 0.59
255 0.54
256 0.53
257 0.57
258 0.58
259 0.6
260 0.57
261 0.62
262 0.61
263 0.6
264 0.56
265 0.54
266 0.53
267 0.51
268 0.51
269 0.46
270 0.48
271 0.45
272 0.45
273 0.38
274 0.32
275 0.27
276 0.26
277 0.25
278 0.2
279 0.24
280 0.24
281 0.25
282 0.25
283 0.23
284 0.22
285 0.18
286 0.22
287 0.23
288 0.23
289 0.22
290 0.23
291 0.23
292 0.22
293 0.21
294 0.18
295 0.13
296 0.12
297 0.09
298 0.08
299 0.07
300 0.08
301 0.06
302 0.04
303 0.04
304 0.04
305 0.06
306 0.06
307 0.08
308 0.08
309 0.09
310 0.1
311 0.11
312 0.14
313 0.14
314 0.18
315 0.19
316 0.21
317 0.28
318 0.33
319 0.33
320 0.34
321 0.32
322 0.29
323 0.27
324 0.25
325 0.19
326 0.14
327 0.17
328 0.14
329 0.19
330 0.2
331 0.2
332 0.2
333 0.22
334 0.22
335 0.21
336 0.25