Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PA54

Protein Details
Accession B8PA54    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-24HLPRPFKNPHYTKNVNRRTKNLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
KEGG ppl:POSPLDRAFT_105976  -  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MHLPRPFKNPHYTKNVNRRTKNLKAVLTHERDRERADRERRRQEKEDAMEVDGEPGDSTPEEEMPTYASIEAPPSLLPQRRYCDITGLEGPYTDPAMGLRYHDKSVYELIKGLSAAAAKDYLAARGVNPIVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.82
4 0.8
5 0.8
6 0.8
7 0.8
8 0.79
9 0.75
10 0.7
11 0.64
12 0.64
13 0.65
14 0.62
15 0.58
16 0.55
17 0.51
18 0.47
19 0.48
20 0.46
21 0.43
22 0.46
23 0.52
24 0.56
25 0.63
26 0.72
27 0.75
28 0.78
29 0.77
30 0.74
31 0.73
32 0.66
33 0.63
34 0.53
35 0.46
36 0.39
37 0.34
38 0.28
39 0.18
40 0.14
41 0.07
42 0.06
43 0.05
44 0.04
45 0.05
46 0.05
47 0.05
48 0.06
49 0.06
50 0.06
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.07
62 0.11
63 0.15
64 0.18
65 0.22
66 0.26
67 0.28
68 0.31
69 0.3
70 0.3
71 0.28
72 0.28
73 0.26
74 0.24
75 0.21
76 0.18
77 0.18
78 0.14
79 0.14
80 0.09
81 0.07
82 0.06
83 0.07
84 0.08
85 0.1
86 0.14
87 0.17
88 0.18
89 0.19
90 0.2
91 0.2
92 0.26
93 0.26
94 0.21
95 0.2
96 0.2
97 0.2
98 0.19
99 0.17
100 0.12
101 0.11
102 0.1
103 0.1
104 0.09
105 0.08
106 0.11
107 0.11
108 0.11
109 0.12
110 0.12
111 0.11
112 0.17