Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8P4I6

Protein Details
Accession B8P4I6    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-131AFKIQTIQKNKKNKKNKKNKKNHCNIDNAYHydrophilic
NLS Segment(s)
PositionSequence
110-122KNKKNKKNKKNKK
Subcellular Location(s) nucl 13, extr 7, mito_nucl 7
Family & Domain DBs
KEGG ppl:POSPLDRAFT_100751  -  
Amino Acid Sequences MREFQVLLSSILEACGGGSVLVDSTLRDDGWQLQWGAVDFRNQGKSKSALKTLCAVPGILPRPSKKAWENSTRWWYESKELTVTQGKVQQFLKFMSDLCILAFKIQTIQKNKKNKKNKKNKKNHCNIDNAYDNSPYTIPVYSDHLCMSPTHTNSVSEPESEEAGGASARELSSNDDVPLVQKVEFQSAVDEGIMESDEDPETEQLLAEAARAATTRKLQKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.05
10 0.05
11 0.08
12 0.09
13 0.09
14 0.09
15 0.1
16 0.13
17 0.16
18 0.19
19 0.17
20 0.17
21 0.18
22 0.18
23 0.2
24 0.17
25 0.17
26 0.16
27 0.2
28 0.27
29 0.27
30 0.28
31 0.3
32 0.34
33 0.38
34 0.41
35 0.44
36 0.38
37 0.39
38 0.42
39 0.4
40 0.37
41 0.31
42 0.26
43 0.2
44 0.25
45 0.26
46 0.24
47 0.27
48 0.25
49 0.3
50 0.31
51 0.36
52 0.35
53 0.41
54 0.45
55 0.51
56 0.54
57 0.57
58 0.64
59 0.6
60 0.55
61 0.49
62 0.43
63 0.39
64 0.37
65 0.31
66 0.25
67 0.24
68 0.27
69 0.28
70 0.27
71 0.24
72 0.26
73 0.24
74 0.25
75 0.26
76 0.24
77 0.21
78 0.21
79 0.21
80 0.15
81 0.15
82 0.15
83 0.15
84 0.13
85 0.11
86 0.12
87 0.1
88 0.1
89 0.1
90 0.07
91 0.1
92 0.12
93 0.18
94 0.24
95 0.33
96 0.39
97 0.5
98 0.59
99 0.65
100 0.74
101 0.79
102 0.82
103 0.86
104 0.9
105 0.9
106 0.93
107 0.94
108 0.94
109 0.94
110 0.92
111 0.86
112 0.83
113 0.73
114 0.68
115 0.63
116 0.54
117 0.45
118 0.36
119 0.31
120 0.23
121 0.22
122 0.16
123 0.11
124 0.1
125 0.09
126 0.09
127 0.14
128 0.14
129 0.15
130 0.15
131 0.14
132 0.14
133 0.14
134 0.18
135 0.19
136 0.19
137 0.21
138 0.22
139 0.22
140 0.23
141 0.28
142 0.23
143 0.18
144 0.18
145 0.16
146 0.15
147 0.14
148 0.13
149 0.08
150 0.07
151 0.07
152 0.06
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.1
159 0.13
160 0.15
161 0.15
162 0.14
163 0.14
164 0.15
165 0.17
166 0.14
167 0.12
168 0.13
169 0.14
170 0.18
171 0.18
172 0.17
173 0.16
174 0.15
175 0.16
176 0.13
177 0.11
178 0.07
179 0.08
180 0.08
181 0.06
182 0.06
183 0.07
184 0.07
185 0.07
186 0.09
187 0.09
188 0.09
189 0.09
190 0.09
191 0.07
192 0.08
193 0.08
194 0.07
195 0.08
196 0.07
197 0.07
198 0.08
199 0.1
200 0.14
201 0.22