Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3R7IK19

Protein Details
Accession A0A3R7IK19    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-27SCDMRRPSTRSRFTPNRLFSHydrophilic
80-119TSSTSSTRPRKPKTQTRARPSSPKRSPRPSRGANKRTRASHydrophilic
NLS Segment(s)
PositionSequence
87-116RPRKPKTQTRARPSSPKRSPRPSRGANKRT
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MLLPSALSCDMRRPSTRSRFTPNRLFSTPPPSDNDYFPSSNGLLGTCRALQSLLGGSPAPPSRRAKPERLQSPFHLPSSTSSTSSTRPRKPKTQTRARPSSPKRSPRPSRGANKRTRASYEADSDADSEAHTPRARYSTPKRRRYVPYDLPLGLSQSDFYSLNSPPTTQSPPSPAQRRQQELCDEVRAPLPPSPSPSSQSQFDPDAALPSIEESGPDSWTSEDDRQLVEVVLEKFQLSKRDWDDCARRLGKDQDSVGRRWEALIGEGNVGLRRGLRMVRGRLDESWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.57
3 0.65
4 0.64
5 0.69
6 0.73
7 0.77
8 0.82
9 0.78
10 0.75
11 0.69
12 0.67
13 0.62
14 0.61
15 0.57
16 0.49
17 0.48
18 0.47
19 0.46
20 0.43
21 0.43
22 0.39
23 0.36
24 0.33
25 0.32
26 0.26
27 0.25
28 0.23
29 0.18
30 0.13
31 0.14
32 0.16
33 0.13
34 0.13
35 0.12
36 0.12
37 0.11
38 0.12
39 0.13
40 0.1
41 0.1
42 0.1
43 0.1
44 0.14
45 0.19
46 0.19
47 0.22
48 0.27
49 0.33
50 0.43
51 0.49
52 0.54
53 0.59
54 0.67
55 0.71
56 0.72
57 0.7
58 0.64
59 0.67
60 0.62
61 0.55
62 0.45
63 0.36
64 0.33
65 0.36
66 0.34
67 0.25
68 0.24
69 0.25
70 0.28
71 0.37
72 0.43
73 0.44
74 0.52
75 0.57
76 0.64
77 0.72
78 0.78
79 0.79
80 0.82
81 0.83
82 0.83
83 0.86
84 0.82
85 0.83
86 0.8
87 0.8
88 0.78
89 0.78
90 0.77
91 0.78
92 0.82
93 0.8
94 0.82
95 0.81
96 0.81
97 0.83
98 0.84
99 0.82
100 0.82
101 0.77
102 0.7
103 0.65
104 0.57
105 0.5
106 0.43
107 0.38
108 0.31
109 0.27
110 0.25
111 0.21
112 0.19
113 0.15
114 0.11
115 0.09
116 0.07
117 0.09
118 0.1
119 0.09
120 0.1
121 0.13
122 0.14
123 0.21
124 0.31
125 0.39
126 0.49
127 0.58
128 0.6
129 0.64
130 0.7
131 0.7
132 0.69
133 0.67
134 0.61
135 0.56
136 0.53
137 0.47
138 0.41
139 0.34
140 0.24
141 0.16
142 0.11
143 0.07
144 0.08
145 0.07
146 0.08
147 0.1
148 0.1
149 0.12
150 0.12
151 0.13
152 0.12
153 0.16
154 0.19
155 0.17
156 0.19
157 0.21
158 0.26
159 0.33
160 0.4
161 0.42
162 0.47
163 0.53
164 0.57
165 0.54
166 0.55
167 0.51
168 0.47
169 0.44
170 0.39
171 0.32
172 0.27
173 0.27
174 0.23
175 0.2
176 0.18
177 0.19
178 0.17
179 0.22
180 0.25
181 0.26
182 0.28
183 0.31
184 0.32
185 0.31
186 0.32
187 0.3
188 0.27
189 0.26
190 0.25
191 0.2
192 0.19
193 0.16
194 0.14
195 0.11
196 0.1
197 0.1
198 0.08
199 0.08
200 0.08
201 0.09
202 0.09
203 0.1
204 0.1
205 0.09
206 0.11
207 0.15
208 0.16
209 0.17
210 0.18
211 0.18
212 0.18
213 0.18
214 0.17
215 0.13
216 0.15
217 0.14
218 0.14
219 0.13
220 0.13
221 0.14
222 0.17
223 0.22
224 0.2
225 0.26
226 0.3
227 0.36
228 0.39
229 0.45
230 0.5
231 0.49
232 0.56
233 0.51
234 0.48
235 0.48
236 0.53
237 0.5
238 0.48
239 0.48
240 0.47
241 0.49
242 0.49
243 0.48
244 0.42
245 0.37
246 0.31
247 0.3
248 0.22
249 0.2
250 0.24
251 0.21
252 0.19
253 0.2
254 0.2
255 0.18
256 0.18
257 0.15
258 0.11
259 0.11
260 0.13
261 0.15
262 0.22
263 0.3
264 0.36
265 0.43
266 0.48
267 0.5