Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A229YEF1

Protein Details
Accession A0A229YEF1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAAGAGKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
6-19GKQKKKWSKGKVKD
Subcellular Location(s) mito 12, cyto 10, nucl 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAAGAGKQKKKWSKGKVKDKAQHAVVLEKQTAERLQKDVQSYRLITVATLVDRLKINGSLARRALADLEEKGQIKKVVGHSKMTIYTRAVTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.88
3 0.89
4 0.9
5 0.89
6 0.85
7 0.82
8 0.73
9 0.66
10 0.56
11 0.51
12 0.43
13 0.39
14 0.32
15 0.25
16 0.23
17 0.21
18 0.22
19 0.19
20 0.18
21 0.18
22 0.2
23 0.23
24 0.26
25 0.27
26 0.27
27 0.27
28 0.26
29 0.23
30 0.22
31 0.19
32 0.14
33 0.13
34 0.11
35 0.08
36 0.09
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.1
44 0.12
45 0.14
46 0.16
47 0.16
48 0.17
49 0.16
50 0.16
51 0.16
52 0.14
53 0.15
54 0.12
55 0.13
56 0.16
57 0.17
58 0.17
59 0.2
60 0.2
61 0.18
62 0.22
63 0.29
64 0.35
65 0.37
66 0.41
67 0.4
68 0.43
69 0.48
70 0.44
71 0.39
72 0.32
73 0.32