Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A229XAK0

Protein Details
Accession A0A229XAK0   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTRGNQRDRDREKNLKAKAKQHydrophilic
NLS Segment(s)
PositionSequence
15-20LKAKAK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.833, cyto_mito 6.833, mito 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MTRGNQRDRDREKNLKAKAKQKGGNPLSGTEFQRAKENNAAIMRAKQAAGQPKQQQGKRSNDSIMEFVSNIFTGNSDPQSRCFPVTIINPSAVVLRFGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.79
4 0.79
5 0.79
6 0.78
7 0.74
8 0.71
9 0.73
10 0.66
11 0.65
12 0.57
13 0.5
14 0.44
15 0.43
16 0.39
17 0.33
18 0.32
19 0.26
20 0.31
21 0.3
22 0.29
23 0.3
24 0.29
25 0.28
26 0.27
27 0.28
28 0.22
29 0.23
30 0.2
31 0.16
32 0.15
33 0.12
34 0.14
35 0.21
36 0.23
37 0.28
38 0.31
39 0.37
40 0.44
41 0.44
42 0.49
43 0.48
44 0.55
45 0.53
46 0.51
47 0.46
48 0.42
49 0.41
50 0.35
51 0.29
52 0.2
53 0.16
54 0.13
55 0.13
56 0.1
57 0.08
58 0.07
59 0.06
60 0.07
61 0.1
62 0.13
63 0.16
64 0.17
65 0.2
66 0.26
67 0.28
68 0.28
69 0.26
70 0.23
71 0.25
72 0.31
73 0.35
74 0.31
75 0.3
76 0.28
77 0.28
78 0.3
79 0.24