Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WSK7

Protein Details
Accession A0A1Y1WSK7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MSGRYYRRYRRRYPYRTYGRRYRYYSRSQRRASRNQKAARQQRDKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MSGRYYRRYRRRYPYRTYGRRYRYYSRSQRRASRNQKAARQQRDKAELNISVPTKIDTFNARISLSNGSDPDTVLDTGVYALNIWDLLRKSEFYQSYARG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.87
5 0.86
6 0.84
7 0.83
8 0.81
9 0.78
10 0.75
11 0.75
12 0.78
13 0.79
14 0.8
15 0.79
16 0.81
17 0.81
18 0.85
19 0.84
20 0.84
21 0.82
22 0.79
23 0.79
24 0.8
25 0.81
26 0.8
27 0.77
28 0.72
29 0.69
30 0.69
31 0.63
32 0.55
33 0.49
34 0.4
35 0.33
36 0.32
37 0.26
38 0.19
39 0.17
40 0.15
41 0.12
42 0.12
43 0.12
44 0.1
45 0.13
46 0.15
47 0.16
48 0.16
49 0.16
50 0.17
51 0.19
52 0.18
53 0.17
54 0.15
55 0.16
56 0.16
57 0.15
58 0.15
59 0.14
60 0.13
61 0.11
62 0.1
63 0.07
64 0.08
65 0.08
66 0.07
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.09
73 0.09
74 0.13
75 0.15
76 0.17
77 0.19
78 0.27
79 0.29
80 0.28