Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X5T2

Protein Details
Accession A0A1Y1X5T2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-78SDANAKQKEKERKECIRRKEYDBasic
NLS Segment(s)
Subcellular Location(s) E.R. 9, mito 5, golg 5, pero 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MKFYSVLAFFLLCTMLVLSNPIRSTEETENKFIEKRAFTDYVMETYKKLIYVIGKASDANAKQKEKERKECIRRKEYDYNNCIAGTSDVRYCSSIQQKNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.09
5 0.09
6 0.12
7 0.13
8 0.14
9 0.16
10 0.16
11 0.22
12 0.28
13 0.36
14 0.35
15 0.38
16 0.38
17 0.37
18 0.37
19 0.33
20 0.3
21 0.22
22 0.21
23 0.24
24 0.24
25 0.23
26 0.26
27 0.24
28 0.23
29 0.23
30 0.21
31 0.16
32 0.16
33 0.16
34 0.12
35 0.12
36 0.1
37 0.09
38 0.11
39 0.12
40 0.12
41 0.12
42 0.12
43 0.13
44 0.15
45 0.15
46 0.19
47 0.23
48 0.23
49 0.26
50 0.35
51 0.45
52 0.5
53 0.59
54 0.62
55 0.67
56 0.76
57 0.82
58 0.83
59 0.83
60 0.79
61 0.78
62 0.79
63 0.78
64 0.77
65 0.73
66 0.66
67 0.58
68 0.52
69 0.44
70 0.35
71 0.28
72 0.2
73 0.18
74 0.18
75 0.18
76 0.19
77 0.2
78 0.2
79 0.26
80 0.34