Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X5D8

Protein Details
Accession A0A1Y1X5D8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-45EQESRSNSNQRKKIRRNSRSNKEIKDHydrophilic
NLS Segment(s)
PositionSequence
30-38RKKIRRNSR
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MEFDDDDETKSKSKMMKKLEQESRSNSNQRKKIRRNSRSNKEIKDVNDELNKEIEKISKELNEEIKRVNKELNKEIEKESKELNKEIEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.52
4 0.58
5 0.68
6 0.74
7 0.74
8 0.71
9 0.69
10 0.67
11 0.64
12 0.64
13 0.62
14 0.61
15 0.63
16 0.67
17 0.72
18 0.75
19 0.79
20 0.82
21 0.85
22 0.87
23 0.9
24 0.9
25 0.89
26 0.87
27 0.79
28 0.72
29 0.66
30 0.56
31 0.53
32 0.44
33 0.38
34 0.34
35 0.31
36 0.28
37 0.26
38 0.24
39 0.17
40 0.16
41 0.16
42 0.14
43 0.14
44 0.16
45 0.16
46 0.18
47 0.21
48 0.29
49 0.3
50 0.29
51 0.33
52 0.37
53 0.37
54 0.37
55 0.4
56 0.35
57 0.38
58 0.44
59 0.49
60 0.46
61 0.47
62 0.51
63 0.52
64 0.51
65 0.47
66 0.46
67 0.44
68 0.44
69 0.44
70 0.43