Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WVI4

Protein Details
Accession A0A1Y1WVI4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-52EPDLTGKKKIYQRCKYPKTRTYSIIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10plas 10, E.R. 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017978  GPCR_3_C  
Gene Ontology GO:0016020  C:membrane  
GO:0004930  F:G protein-coupled receptor activity  
Pfam View protein in Pfam  
PF00003  7tm_3  
Amino Acid Sequences MYGIVIFMILFHIMICTLWTILHKIESEPDLTGKKKIYQRCKYPKTRTYSIIFNFAVLFLGCYFSYQIRYVKRNFQENLVLTVYVYVVTMIITEIINLQDKISITVKDSLSAAATILNTSVILIYLYFIKFYAIYNNTADTNIPIDLLSLPGKGEPFGSKTNLINRSNDSNINRFLSNNNINRSNDSNINRFLSNNNINRSIDSNISRFLSNNNIID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.06
5 0.07
6 0.09
7 0.11
8 0.12
9 0.15
10 0.15
11 0.15
12 0.19
13 0.2
14 0.2
15 0.19
16 0.21
17 0.23
18 0.24
19 0.27
20 0.26
21 0.32
22 0.37
23 0.45
24 0.52
25 0.57
26 0.67
27 0.74
28 0.82
29 0.85
30 0.89
31 0.87
32 0.85
33 0.81
34 0.76
35 0.68
36 0.67
37 0.58
38 0.55
39 0.47
40 0.39
41 0.33
42 0.27
43 0.24
44 0.15
45 0.13
46 0.06
47 0.08
48 0.07
49 0.08
50 0.09
51 0.09
52 0.12
53 0.14
54 0.19
55 0.22
56 0.27
57 0.3
58 0.38
59 0.42
60 0.47
61 0.45
62 0.44
63 0.45
64 0.41
65 0.42
66 0.34
67 0.29
68 0.21
69 0.2
70 0.16
71 0.1
72 0.08
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.03
80 0.03
81 0.04
82 0.05
83 0.06
84 0.06
85 0.06
86 0.07
87 0.07
88 0.1
89 0.11
90 0.11
91 0.11
92 0.16
93 0.16
94 0.15
95 0.15
96 0.13
97 0.12
98 0.11
99 0.1
100 0.06
101 0.06
102 0.05
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.05
113 0.05
114 0.05
115 0.05
116 0.06
117 0.06
118 0.06
119 0.12
120 0.13
121 0.15
122 0.15
123 0.17
124 0.17
125 0.17
126 0.17
127 0.11
128 0.11
129 0.09
130 0.08
131 0.07
132 0.07
133 0.07
134 0.08
135 0.08
136 0.07
137 0.07
138 0.08
139 0.08
140 0.08
141 0.09
142 0.09
143 0.12
144 0.15
145 0.17
146 0.19
147 0.22
148 0.3
149 0.37
150 0.37
151 0.36
152 0.37
153 0.4
154 0.4
155 0.44
156 0.4
157 0.36
158 0.38
159 0.38
160 0.35
161 0.3
162 0.29
163 0.31
164 0.36
165 0.38
166 0.4
167 0.43
168 0.44
169 0.47
170 0.49
171 0.45
172 0.45
173 0.43
174 0.42
175 0.4
176 0.41
177 0.37
178 0.34
179 0.31
180 0.32
181 0.36
182 0.38
183 0.4
184 0.41
185 0.42
186 0.43
187 0.44
188 0.38
189 0.36
190 0.34
191 0.31
192 0.3
193 0.31
194 0.3
195 0.27
196 0.27
197 0.3