Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X4N0

Protein Details
Accession A0A1Y1X4N0    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
145-182TSSGKTPKSKSKSKSKSKNRTRTHSHSHPKPKKSLKGFHydrophilic
NLS Segment(s)
PositionSequence
149-180KTPKSKSKSKSKSKNRTRTHSHSHPKPKKSLK
Subcellular Location(s) mito 12, plas 8, pero 2, E.R. 2, nucl 1, cyto 1, cyto_nucl 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAREELRVFMDNIANFITSTKMELISGPKGLLSSVIKKEINFLIFLTIVYLVTLVIKQRSRTMYKYLVTLTIGVIVVYTSYVTSIFDESIKDGTASEEVFKNLPPVCVCIIIKLLHIVPPLKLVYYTLPIFMIAYSIYYHNLLKTSSGKTPKSKSKSKSKSKNRTRTHSHSHPKPKKSLKGFIRVSLSLFTDFIHSFILFYAYAVLVLLIFINNNYDYTINSINSGSNVYGKVLRFIDIPFLNKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.15
5 0.1
6 0.13
7 0.13
8 0.12
9 0.12
10 0.14
11 0.18
12 0.19
13 0.2
14 0.18
15 0.17
16 0.16
17 0.16
18 0.17
19 0.17
20 0.21
21 0.24
22 0.3
23 0.31
24 0.31
25 0.35
26 0.35
27 0.32
28 0.26
29 0.22
30 0.18
31 0.17
32 0.17
33 0.14
34 0.1
35 0.09
36 0.08
37 0.07
38 0.05
39 0.05
40 0.07
41 0.07
42 0.12
43 0.14
44 0.16
45 0.21
46 0.27
47 0.32
48 0.34
49 0.39
50 0.41
51 0.4
52 0.42
53 0.37
54 0.33
55 0.29
56 0.26
57 0.19
58 0.14
59 0.13
60 0.09
61 0.08
62 0.06
63 0.05
64 0.05
65 0.05
66 0.03
67 0.03
68 0.04
69 0.04
70 0.05
71 0.06
72 0.07
73 0.07
74 0.08
75 0.08
76 0.09
77 0.09
78 0.08
79 0.07
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.1
87 0.09
88 0.12
89 0.11
90 0.13
91 0.11
92 0.13
93 0.13
94 0.15
95 0.15
96 0.13
97 0.14
98 0.13
99 0.13
100 0.12
101 0.12
102 0.1
103 0.12
104 0.11
105 0.09
106 0.11
107 0.11
108 0.1
109 0.1
110 0.09
111 0.09
112 0.11
113 0.11
114 0.09
115 0.09
116 0.09
117 0.09
118 0.08
119 0.07
120 0.04
121 0.04
122 0.05
123 0.05
124 0.06
125 0.07
126 0.08
127 0.08
128 0.09
129 0.08
130 0.1
131 0.12
132 0.15
133 0.19
134 0.26
135 0.29
136 0.34
137 0.41
138 0.49
139 0.53
140 0.59
141 0.6
142 0.65
143 0.72
144 0.77
145 0.81
146 0.83
147 0.87
148 0.89
149 0.93
150 0.9
151 0.89
152 0.87
153 0.84
154 0.83
155 0.82
156 0.81
157 0.81
158 0.84
159 0.84
160 0.81
161 0.82
162 0.82
163 0.8
164 0.78
165 0.78
166 0.73
167 0.75
168 0.71
169 0.67
170 0.63
171 0.54
172 0.48
173 0.4
174 0.34
175 0.25
176 0.22
177 0.17
178 0.15
179 0.14
180 0.13
181 0.13
182 0.12
183 0.11
184 0.11
185 0.12
186 0.09
187 0.09
188 0.09
189 0.07
190 0.07
191 0.07
192 0.07
193 0.04
194 0.04
195 0.05
196 0.03
197 0.04
198 0.04
199 0.06
200 0.07
201 0.07
202 0.09
203 0.09
204 0.09
205 0.14
206 0.18
207 0.16
208 0.17
209 0.17
210 0.17
211 0.17
212 0.19
213 0.15
214 0.14
215 0.14
216 0.15
217 0.19
218 0.19
219 0.23
220 0.22
221 0.23
222 0.21
223 0.21
224 0.27
225 0.26
226 0.3