Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WXT6

Protein Details
Accession A0A1Y1WXT6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MAEKSKVQKSPKTKVNKTKNNKQVKSKEPVNKSKTHydrophilic
NLS Segment(s)
PositionSequence
14-14K
17-17K
Subcellular Location(s) nucl 11.5, cyto_nucl 8, mito 4, cyto 3.5, plas 2, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR041183  Cyclophilin-like  
IPR029000  Cyclophilin-like_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF18050  Cyclophil_like2  
Amino Acid Sequences MAEKSKVQKSPKTKVNKTKNNKQVKSKEPVNKSKTSSLVIGSVVVLILSIVLTLAFPYLKDNITSLTKSTTTTTTQEGTEKLSNIVKRQHDEFHPKLIISSDNNSEAKYEFKCTFEINETTKELVKQFPLTMKMVDLNGNEKYHTLETPLPVRIQPVDKVRLGDILLFQSRYLAVFYDTFDPVKKYSIVGKIDNPEKLREAVGTGSITAQFIQDDYSQDDKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.87
4 0.88
5 0.89
6 0.9
7 0.91
8 0.88
9 0.88
10 0.87
11 0.84
12 0.83
13 0.82
14 0.82
15 0.8
16 0.83
17 0.79
18 0.76
19 0.72
20 0.69
21 0.63
22 0.56
23 0.48
24 0.39
25 0.34
26 0.28
27 0.23
28 0.17
29 0.13
30 0.1
31 0.08
32 0.06
33 0.04
34 0.03
35 0.03
36 0.02
37 0.02
38 0.02
39 0.02
40 0.03
41 0.03
42 0.03
43 0.04
44 0.06
45 0.08
46 0.09
47 0.09
48 0.1
49 0.12
50 0.16
51 0.16
52 0.15
53 0.16
54 0.17
55 0.17
56 0.19
57 0.18
58 0.18
59 0.19
60 0.21
61 0.19
62 0.19
63 0.2
64 0.19
65 0.2
66 0.19
67 0.18
68 0.17
69 0.2
70 0.2
71 0.22
72 0.28
73 0.27
74 0.28
75 0.3
76 0.32
77 0.33
78 0.41
79 0.39
80 0.38
81 0.36
82 0.33
83 0.31
84 0.28
85 0.25
86 0.17
87 0.18
88 0.14
89 0.17
90 0.17
91 0.17
92 0.17
93 0.15
94 0.15
95 0.14
96 0.16
97 0.13
98 0.14
99 0.15
100 0.15
101 0.16
102 0.17
103 0.19
104 0.18
105 0.19
106 0.19
107 0.19
108 0.19
109 0.19
110 0.17
111 0.15
112 0.14
113 0.13
114 0.13
115 0.15
116 0.17
117 0.17
118 0.16
119 0.15
120 0.15
121 0.15
122 0.16
123 0.14
124 0.14
125 0.16
126 0.16
127 0.15
128 0.14
129 0.16
130 0.15
131 0.14
132 0.14
133 0.14
134 0.16
135 0.19
136 0.2
137 0.19
138 0.18
139 0.19
140 0.19
141 0.19
142 0.22
143 0.24
144 0.27
145 0.28
146 0.29
147 0.28
148 0.27
149 0.25
150 0.21
151 0.16
152 0.16
153 0.16
154 0.15
155 0.15
156 0.13
157 0.13
158 0.13
159 0.12
160 0.08
161 0.09
162 0.09
163 0.11
164 0.14
165 0.15
166 0.15
167 0.16
168 0.17
169 0.17
170 0.19
171 0.18
172 0.16
173 0.21
174 0.28
175 0.31
176 0.33
177 0.37
178 0.42
179 0.46
180 0.51
181 0.46
182 0.42
183 0.4
184 0.38
185 0.33
186 0.26
187 0.23
188 0.19
189 0.2
190 0.17
191 0.15
192 0.15
193 0.14
194 0.14
195 0.12
196 0.11
197 0.09
198 0.08
199 0.11
200 0.11
201 0.13
202 0.18