Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8P3F5

Protein Details
Accession B8P3F5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-88RLSNPGYRYKPERKKTGRPPKBasic
NLS Segment(s)
PositionSequence
75-88RYKPERKKTGRPPK
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG ppl:POSPLDRAFT_28443  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences SKGPNHIPRPLNCFILFKNDYIRRLHESGYKAMSKDIVKEIGAQWRLLPENERRYWKDKAKEVKDDHRLSNPGYRYKPERKKTGRPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.37
4 0.3
5 0.37
6 0.37
7 0.38
8 0.38
9 0.41
10 0.37
11 0.38
12 0.39
13 0.35
14 0.33
15 0.33
16 0.35
17 0.33
18 0.27
19 0.26
20 0.27
21 0.22
22 0.21
23 0.2
24 0.17
25 0.15
26 0.16
27 0.17
28 0.2
29 0.2
30 0.18
31 0.15
32 0.16
33 0.17
34 0.16
35 0.18
36 0.18
37 0.25
38 0.29
39 0.34
40 0.36
41 0.41
42 0.48
43 0.52
44 0.54
45 0.54
46 0.61
47 0.62
48 0.68
49 0.69
50 0.71
51 0.73
52 0.7
53 0.65
54 0.61
55 0.56
56 0.5
57 0.51
58 0.46
59 0.45
60 0.44
61 0.47
62 0.49
63 0.58
64 0.66
65 0.67
66 0.73
67 0.74
68 0.81