Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WEL9

Protein Details
Accession A0A1Y1WEL9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-45LKKTKKQKNKKTINKKQKTKKQKNKKTINKKQKTKKQKSFIKSLNHydrophilic
NLS Segment(s)
PositionSequence
2-38KKTKKQKNKKTINKKQKTKKQKNKKTINKKQKTKKQK
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences LKKTKKQKNKKTINKKQKTKKQKNKKTINKKQKTKKQKSFIKSLNLINFKIINFVNSYQYETNLLFKVLLFFNNHIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.95
3 0.95
4 0.94
5 0.95
6 0.95
7 0.94
8 0.94
9 0.95
10 0.95
11 0.95
12 0.95
13 0.95
14 0.95
15 0.96
16 0.95
17 0.95
18 0.95
19 0.94
20 0.95
21 0.94
22 0.93
23 0.91
24 0.9
25 0.84
26 0.82
27 0.77
28 0.73
29 0.66
30 0.6
31 0.58
32 0.52
33 0.47
34 0.39
35 0.34
36 0.27
37 0.26
38 0.21
39 0.15
40 0.14
41 0.15
42 0.18
43 0.18
44 0.22
45 0.19
46 0.2
47 0.22
48 0.2
49 0.22
50 0.18
51 0.18
52 0.14
53 0.14
54 0.16
55 0.15
56 0.16
57 0.17